KEGG   Streptomyces formicae: KY5_4861Help
Entry
KY5_4861          CDS       T05416                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfk  Streptomyces formicae
Pathway
sfk00564  Glycerophospholipid metabolism
sfk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KY5_4861
Enzymes [BR:sfk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KY5_4861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATL29879
UniProt: A0A291QDU9
LinkDB All DBs
Position
5648707..5650416
Genome map
AA seq 569 aa AA seqDB search
MRTATLGPAERAESLAGMADRELDVLVVGAGVVGAGTALDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSMSRGHGRGLPTHRHLTRRHALRVAPCLKKDALVGAMQYYDAQMDDARY
VATLVRTAAAYGAKVANRAKVTGFLREGERVVGARVQDVEGGGEYEIRAKQIVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRINSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAVPLSRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVADCVTEDVPLVGAEGYKAM
WNARARIAARTGLHVVRVEHLLNRYGSLAEEVLDLVTADPTLGAVLQGADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSARECAELMAPVLGWDKDQIEREVQHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPLN
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactggggccggcggagcgtgccgagtcacttgcgggaatggccgac
cgggagctggacgtcctggtcgtgggcgcgggggtggtcggtgcggggacggcactcgac
gcggtcacccgcggcctgtccaccggcctggtcgaggccagggactgggcgtccggcacg
tcgagccggtcgagcaagctgatccacggcggcctgcgctatctggagatgctcgacttc
gcgctcgtgcgggaggcgttgaaggagcgcgggctcctcctggagcggctcgccccgcac
ctggtgaagccggtgccgttcctctaccccttgcagcacaagggctgggagcggttgtac
gcgggatcgggcgtcgcgctctacgacgccatgtcgatgtcgcgcggacacggcaggggt
ctgcccacccaccgccacctgacccggcgtcacgcgctgcgcgtcgccccctgcctgaag
aaggacgccctggtcggggcgatgcagtactacgacgcgcagatggacgacgcccgctac
gtggccacgctggtgcgcacggcggcggcgtacggcgcgaaggtcgccaaccgggccaag
gtcaccggcttcctgcgcgagggcgagcgcgtggtcggcgcccgcgtgcaggacgtggaa
ggcggcggggagtacgagatcagggccaagcagatcgtgaacgccaccggcgtgtggacg
gacgacacgcaggccatggtcggcgagcggggacagttccacgtcagggcgtccaagggc
atccacctcgtggtgcccaaggaccggatcaactccacgaccggcctgatcctgcggacc
gagaagagcgtcctgttcgtcatcccgtgggggcggcactggatcgtgggcacgaccgac
acggactgggacctcgacaaggcgcatccggccgcgtccagcgccgacatcgactatctc
ctcgagcacgtgaactcggtgctcgcggtgccgctctcgcgggacgacgtccagggggtg
tacgcggggctgcggccgctgctcgccggggagtcggacgccacgagcaagctgtcgcgc
gagcacacggtcgcgcatccggcccccggtctcgtggtcgtcgcgggcggcaagtacacg
acgtaccgcgtgatggccaaggacgccgtggacgaggcggtgcacggcctggaccagcgc
gtcgccgactgcgtcacggaggacgtcccgctggtcggcgccgagggctacaaggcgatg
tggaacgcgcgcgccaggatcgccgcgcggacgggccttcatgtggtgcgtgtggagcac
ctgttgaaccggtacggctcgctggccgaggaagtgctcgacctggtgaccgccgacccc
acgctcggcgcggtgctgcagggcgcggacgactatctgcgcgccgaggtggtgtacgcg
gcctcgcacgagggcgcgaggcacctggacgacgtgctgacgcggcgcacgcgcatctcg
atcgagaccttcgaccggggcacgcgcagcgcccgcgagtgcgccgaactgatggcgccc
gtcctgggctgggacaaggaccagatcgagcgggaggtccagcactacgagaagcgggtg
gaggccgagcgcgagtcgcagcggcagccggacgacctgaccgcggacgcggcgcggctc
ggcgcgccggacatcgtgccgctcaactag

DBGET integrated database retrieval system