KEGG   Streptomyces formicae: KY5_8017c
Entry
KY5_8017c         CDS       T05416                                 

Definition
(GenBank) (Carboxyethyl)arginine beta-lactam-synthase
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
sfk  Streptomyces formicae
Pathway
sfk00331  Clavulanic acid biosynthesis
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
Module
sfk_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    KY5_8017c
Enzymes [BR:sfk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     KY5_8017c
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase tRNA_Me_trans
Other DBs
NCBI-ProteinID: ATL33035
UniProt: A0A291QNI2
LinkDB
Position
complement(9441087..9442616)
AA seq 509 aa
MTPNSPAAIGFLTELRQDGGHVPAPTFAARASRATWHERTADRTLHAVLLHSGAPDEACA
RARGRTLVFAGELYNRDELHRLLPPGRALPGNDAALVIALFGVYDLHVFRLLNGRFAALV
TESGRAVLATDHAGSVPLYVSVAPGRVLAATEAKALRNAPAGRPVPARPVRGLPGTHQVP
AGTVLDIEVATGKCVPHRTWAPPLARRILPEEEAVDAVRRAVERAVRTRTAGGTPLVVLS
GGIDSSTVAALAARRAARPVDTVSMGTDEADEFPQARVVARHVGSAHREITVPTTELLRR
LPHTVWAAECLDPDIVEYLLPLTALYVRIGGPGRRVLTGYGADIPLGGMHRENRLPRLDT
AVCHDMETFDGLNEMTPTLSAVGGHWSTHPYWDRDVLDVLVSLEAGLKHRHGQDKWVLRA
AMSDVLPHEVVVRPKLGVHEGSGTSSSFSRLLADAGAPPDRVRQAKRLVVREIFDQVVVG
GRHPDDVALDAVVELAASRLTGAARPVPR
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgacaccgaactcccccgccgccatcggcttcctcaccgaactccgccaggacggcggg
cacgtgcccgcaccgaccttcgcggcacgcgcctcgcgggcgacgtggcacgaacgaacg
gccgaccgcaccctgcacgccgtactcctgcactccggagcaccggacgaggcctgcgcc
cgcgcccggggcaggacgctggtgttcgccggagagctgtacaaccgggacgagctgcac
cggctcctgccgccggggcgcgcgctgccgggcaacgacgccgcgctcgtcatcgccctg
ttcggcgtctacgaccttcacgtcttccggctcctgaacgggcggttcgccgccctggtg
acggagtccgggcgggcggtgctcgccacggaccacgcgggctcggtgccgctgtacgtc
tccgtcgccccggggcgcgtcctcgccgcgacggaggcgaaggcgctgcggaacgcgccg
gccgggcgtcccgtgcccgcccgccctgtgcgggggctgcccggcacccaccaggtgccg
gccggcacggtcctcgacatcgaggtggccaccgggaagtgcgtcccgcaccgcacgtgg
gcgccgccgctcgcccgccggatcctgccggaggaggaggcagtcgacgccgtgcgccgg
gcggtggagcgcgcggtgcggacccgcacggcaggtggcacgcccctggtggtgctctcg
ggaggcatcgattcctcgaccgtcgcggcgctggccgcccgtcgggcggccaggcccgtc
gacaccgtgtcgatgggaaccgacgaggccgacgagttcccgcaggcgcgcgtcgtggcc
cggcacgtcggctccgcgcaccgggagatcaccgtcccgaccactgagctgctgcggcgg
cttccgcacacggtctgggccgccgaatgcctcgacccggacatcgtcgaatacctgctg
ccgctgaccgccctgtacgtgcggatcggcggcccggggcggcgcgtcctcaccggttac
ggggccgacatcccgctcggcggcatgcaccgcgagaaccggctgcctcggctcgacacg
gccgtctgccacgacatggagaccttcgacggcctcaacgagatgacgccgacgctctcc
gcggtgggcggccactggtcgacccacccctactgggaccgcgacgtcctcgacgtcctg
gtgtccctggaggcagggctcaagcaccgtcacgggcaggacaagtgggtgctgcgcgcc
gccatgagcgacgtcctgccgcacgaggtcgtcgtccgccccaagctcggcgtgcacgag
ggatcgggcaccagctcgtccttctcccggctcctggcggacgccggggccccgcccgac
cgcgtgcgccaggccaagcgcctggtcgtccgggagatcttcgatcaagtcgtcgtcggc
ggacgccatccggacgacgtggcgctcgacgcggtggtcgaactggccgcctcccggctg
accggcgccgcccgtcccgttccgcgatga

DBGET integrated database retrieval system