KEGG   Scleropages formosus (Asian bonytongue): 108919203
Entry
108919203         CDS       T04919                                 

Gene name
xrcc1
Definition
(RefSeq) DNA repair protein XRCC1
  KO
K10803  DNA-repair protein XRCC1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108919203 (xrcc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108919203 (xrcc1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     108919203 (xrcc1)
SSDB
Motif
Pfam: XRCC1_N BRCT BRCT_2 PTCB-BRCT LIG3_BRCT SLC12
Other DBs
NCBI-GeneID: 108919203
NCBI-ProteinID: XP_018582551
LinkDB
Position
18
AA seq 612 aa
MPEIKLKHVVSCSSEDSTHKAENLLSSDTYRKWKSARPGEKQTSVILQFEKEEQVHSIDI
GNDGSAFVEVLVGHSTSVKDQDYEVLLVTSSFMSPSESRNGTNTNRVRFFGPNQLVKATA
QEKWDRVKIVCTQPYSKSIAYGIAFVKFHSPPDDNEPPSKTSPKLTKLGQFRVKEETVST
GSTLQPGSLFFNRESVSKASASPKVSPPNEKLSYAAAALQSSSPSHYTPASSSTQPAAKR
KFEFSKERQSAPVPATAKKLNLLASPEPSGGSSKARLKASAAETPSPSSAKASAVQKTHG
PNKRESRVKPEPKPKAKSTEAVPMDQILEGVVFVLSGFQNPFRGELRDKALAMGAKYRPD
WTPDATHLICAFANTPKYSQVKASGGIIVRKEWVLDCHKRKQKISYKRYLMDGAESSSEE
SEAEDNESEEEQGKKEKRTTPTVKQEDQEEDEYGGSTDVDDPGSEDSGMDTEDELKRAES
QCRQSRTAQDVSDKGEDAYGGSTDENTDAEAEEDKPIPELPDFLTGKHFFFYGKFPLNER
RLLLRYIIAFNGTVEEYMNEKVQFVITAEGWHNSFEDALMENSSLSFVKPSWIFAINDRQ
KMLPYQPYTVVP
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgcctgaaatcaaactgaagcacgtcgtgtcctgcagtagtgaggatagtactcacaaa
gcagagaacctgctgagttctgacacctacaggaaatggaaatcagcaagaccaggggag
aagcagacttcagtcatactgcagtttgagaaggaggaacaggtacatagcattgacatt
gggaatgacggatcagctttcgtcgaggtgctggtgggacactccacctctgtcaaggat
caggactatgaggttctgttggtaacctcttccttcatgtctccctctgagagccgtaat
ggcaccaacaccaaccgggtacgattttttggacctaatcagctggtgaaggcaacagcc
caggagaagtgggatcgagtcaagattgtctgcacccagccatacagtaagagcatagct
tatggcattgcttttgtgaaatttcactctccccctgatgacaatgaaccacctagtaaa
acatcgccaaagctgaccaaactgggacagtttcgtgtgaaagaggagacagtttccaca
ggctccactttgcaaccaggcagcctctttttcaaccgtgagagcgtctccaaagctagt
gccagccccaaggtctcacccccaaatgagaagcttagctatgctgctgcagcccttcag
tccagttctccatcccattacacccctgcatcctccagcacacagccagcagcaaagagg
aagtttgagttcagtaaggaacgtcagtcagcccctgtgccagccactgccaagaaactg
aatttgttggcctccccagaacccagcggtggaagttccaaagctcgattgaaagccagc
gctgcagaaacccccagccctagctctgcaaaggcctctgctgtacagaagactcatggg
cctaacaaaagggagagcagggtgaagccggagcccaagccaaaggccaagtccaccgag
gctgtgcccatggaccagatcttggagggtgtagtgtttgtacttagtggcttccagaac
ccctttcggggtgagctgcgtgacaaagcattggccatgggtgctaaatatcggcctgac
tggactccagatgccactcacctaatctgtgcatttgccaacacacccaaatacagccag
gtgaaggcatcaggtggcatcattgtgaggaaggagtgggtgctggactgccataaacgg
aagcagaagatctcctacaagcgatatctcatggatggagcagagtccagctctgaggag
agcgaagcagaggataatgagagtgaagaggagcaagggaagaaagagaaacgaaccact
ccaacagtaaagcaggaagatcaagaagaggacgagtatgggggctccaccgatgtcgat
gatccaggcagtgaagactcagggatggacactgaggatgagctgaagagggctgaaagc
cagtgccgccagagtagaacagcacaggacgtgagtgacaaaggtgaggatgcatacggg
ggttccactgatgagaacacagatgctgaagcagaggaggacaagcccatcccagagctg
ccagacttcctgactgggaaacacttctttttctatggcaaattccccctgaatgagagg
cgccttttgctgagatacatcatcgctttcaatggcacggtggaagagtacatgaatgag
aaagtgcagtttgtcatcactgccgagggttggcataactccttcgaggacgctctcatg
gagaacagcagtttgagctttgttaaaccctcttggattttcgccattaacgatcgacag
aagatgctgccgtatcagccctacactgttgtgccataa

DBGET integrated database retrieval system