KEGG   Scleropages formosus (Asian bonytongue): 108937809Help
Entry
108937809         CDS       T04919                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108937809 (lig1)
   03410 Base excision repair
    108937809 (lig1)
   03420 Nucleotide excision repair
    108937809 (lig1)
   03430 Mismatch repair
    108937809 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108937809 (lig1)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108937809 (lig1)
Enzymes [BR:sfm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108937809 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     108937809 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108937809 (lig1)
DNA replication proteins [BR:sfm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108937809 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108937809 (lig1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108937809 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     108937809 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     108937809 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 108937809
NCBI-ProteinID: XP_018613483
UniProt: A0A1W5AJ56
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MQRSIASFFQPMKEKEKEGRKTDGQNKERTELVKSPLKPQNGLQECDSPVKKVTKRCRQI
IDSDDDEQPVVKEQAANQACSLTPGKQTVGKTPAFASPIAAPGSSPVPSTPVTPASSGTP
DSPATSVSPGTPSSISPSGILKRKTARKRFPKRKLDSGCTSEEGTEPEGNQAKRSRTEQV
PEVSDHETEAAEEDQKDIADPNESMEVQEHKEEQVVGTMEGKVKEKEKNTEKVEEDQSPP
KVTKQEGKADSEKKKPISSFFAPRKAAAKLEKSEETVNGEGEKQLGATKEKAAGNEKGTV
RSGKAGILSQTEYDPSRPNYHPVEHACWSQGQRVPYLAVARTFEKIEEEMGRLKNIETLS
NLLRSVVALSPDDLLCCIYLCLNQLGPAYLGMELGVGETVLMKAVAQATGRQLDKIKAEA
QEKGDLGLVAESSRSNQRMMFTPANLTAAGVFSKLKDIANMSGNASMNKKIDIIKGLFVA
CRHSEARYIVRSLAGKLRIGLAEQSVLAALAQAVCLTPPGQEFPLQVIDAGKSMSSETRR
TWLEKKTLILKQTYCEMPSYDVIVPVLLKEGIDELPQHCKLTPGVPLRPMLAHPTKGVSE
VMKRFDEAAFTCEYKYDGERAQIHILENGEVRIFSRNQEDNTTKYPDIITRVPQVKKASV
RSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDASDIKVQVCVYAFDLLYLNGESLVRE
PLSWRRALLRESFEEREGEFMFARSLDSDNTDTIAEFLEQSVRDSCEGLMVKTLEKDATY
EIAKRSHNWLKLKKDYLDGVGDTVDLCVIGAYLGKGKRAGSYGGYLLACYDEENEEYQSV
CKIGTGFKDEDLEQHFNFFKEHVLQKLRPYYRVDQSAEPDVWLEAVQVWEVKCADLSLSP
VHKAAMGLVEPDKGISLRFPRFLRIRDDKKPEDSTTGAQIADLYRKQQQIQNQGAADRAD
PEDYY
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagcatcgcgtcgttctttcaacccatgaaagaaaaggagaaggagggacga
aaaactgatggacagaataaagagaggacagaactagttaaatcgccactaaaacctcaa
aatgggctgcaggaatgtgactcgcctgtaaagaaagtcacaaagcgctgccggcaaatc
atagacagcgatgatgatgaacagcctgttgtgaaggagcaggcagccaatcaagcttgt
tctctcactcctggaaagcagacagtcgggaagacacctgcatttgcatctcctatagct
gctccaggttcttcacctgttccctctacaccagttactccagcttcctcaggtactcca
gatagtcctgccacctcagtatccccaggcaccccgtcctccatctccccttcaggaatc
ctgaagcgcaagactgccagaaagcgttttccgaaaagaaagctggacagtggatgtacc
agtgaggagggaacagaaccggaaggaaaccaagcaaagaggtcccggacagagcaagtt
ccagaagtgtcagatcatgagactgaagctgcagaagaggaccagaaagatattgctgat
ccaaacgaaagcatggaagtacaggagcataaggaggagcaggtggttggaacaatggag
ggaaaggttaaagagaaagaaaaaaatactgaaaaggttgaagaggatcagagtcctcca
aaagtgacaaagcaggaaggcaaagcagactctgagaagaaaaagcccataagcagtttc
tttgcaccaaggaaagcagcagcaaaactggaaaaatcagaggagactgtgaatggcgaa
ggagagaaacagctgggtgcaacaaaagagaaggcagcggggaatgagaaagggacagtg
agaagtggaaaggctggaattttgagccagactgagtatgatccatccaggcccaactac
catcctgtggagcatgcctgctggagtcagggtcaaagggtgccctatctggctgttgct
cgtacgtttgagaaaatagaggaggaaatgggcaggttgaagaacatagagaccctgtca
aacctgctgcgttccgtggtggcgctctctccagatgacctgctctgttgcatatacctg
tgtctgaaccagttgggtcctgcttacttgggaatggagctcggagttggggaaactgtg
ctgatgaaggctgttgcccaggcaaccgggcgacagttggacaaaatcaaggcagaggct
caggagaaaggggacctgggattggtggccgagagctcacgtagcaaccagagaatgatg
tttaccccggccaatctgacagcggctggtgtgttcagcaagctcaaggacatagccaac
atgagtggaaatgcttctatgaataaaaaaattgacatcatcaaaggcctgtttgtggcc
tgcagacactctgaagcccgatacatcgtgaggtctctggctgggaagctgcggattggt
ctggcagagcagagcgtactggcggccttggcgcaagcagtgtgcctgacccctccaggg
caagagtttcctctgcaggtgattgatgctggaaagagcatgagctcagagacccgcagg
acctggcttgagaaaaagaccctcattctaaagcagacatactgcgagatgccgagctat
gatgtcattgttccagtcctgctgaaggagggaattgatgaactacctcagcactgcaag
ctcacgccaggagtccccctgaggcccatgctggctcaccccactaagggtgtgtctgag
gtgatgaagcggtttgacgaagctgcgtttacctgcgaatacaagtatgatggagagaga
gcacagatccatattctggagaatggggaggttcgcatcttcagccgcaatcaggaggac
aacacgactaaatatccagacatcatcactcgtgtaccacaagtaaaaaaggcttctgtg
cgctcctgtgtgcttgactcggaggcagtggcctgggacagggagaagaagcagatccag
ccctttcaggtgctaacgacacggaagagaaaggatgtggatgcgtctgacatcaaggtg
caggtctgtgtctatgcctttgacctgctttacctgaatggagagtctctggtcagagag
cccctctcctggcgtagggccttgttgagagagagctttgaggagcgtgagggggagttt
atgtttgcccgctcgcttgactcagacaacacggacactattgccgagttccttgagcag
tctgttcgagactcttgtgagggtcttatggtgaagaccttagagaaggatgccacctat
gaaatcgctaagcgctcacacaactggctcaagctgaaaaaggactacctggatggggta
ggggacaccgtggacctgtgtgtgattggtgcctacctgggcaagggcaagagggcgggg
tcatatgggggttacctgttagcctgctacgacgaggagaacgaggagtaccagtctgtg
tgcaagattggaacaggctttaaggatgaggatttggagcagcattttaatttcttcaag
gaacatgtgttgcagaagctccgtccgtactaccgcgttgaccaatcagctgagcctgac
gtgtggttggaggcggtacaagtgtgggaagtgaagtgtgctgacctgtcactctctcca
gttcacaaagctgccatgggattggtggaaccagacaagggcatctccctacggttccct
cgtttcctcagaatcagagatgacaagaaaccagaagattccacgacaggagcacagatt
gcagatctgtaccggaaacagcagcagatccagaaccagggagctgccgatagagccgac
ccagaggactactactga

DBGET integrated database retrieval system