KEGG   Staphylococcus felis: C7J90_07525Help
Entry
C7J90_07525       CDS       T05459                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sfq  Staphylococcus felis
Pathway
sfq00020  Citrate cycle (TCA cycle)
sfq00190  Oxidative phosphorylation
sfq00650  Butanoate metabolism
sfq01100  Metabolic pathways
sfq01110  Biosynthesis of secondary metabolites
sfq01120  Microbial metabolism in diverse environments
sfq01130  Biosynthesis of antibiotics
sfq01200  Carbon metabolism
Module
sfq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C7J90_07525
   00650 Butanoate metabolism
    C7J90_07525
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C7J90_07525
Enzymes [BR:sfq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C7J90_07525
    1.3.5.4  fumarate reductase (quinol)
     C7J90_07525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8 DAO
Motif
Other DBs
NCBI-ProteinID: AVP36809
UniProt: A0A2K3Z8W3
LinkDB All DBs
Position
1613087..1614853
Genome map
AA seq 588 aa AA seqDB search
MAEKKIIVVGGGLAGLMATIKAAEQGAHVDLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLADQPPVQKMTEAAPKIIHLLDRMGVMFNRTKEGLLDFRRFGGTL
HHRTAFAGATTGQQLLYALDEQVRSFEVDGLVTKYEGWEFLGVVKDDENAARGIVAQNIT
TSEIQSFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGVKYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIEGLFAAGECDFSQHGGNRLGANSLLSAIYGGSVAGPNAVKYVENIEKSYVDL
DEDIYRKREDEEQERFDQLLNMKGTENAYKLHRELGEIMTANVTVVRHNEKLLETDKKIV
ELMKRYEDIDMEDTSQWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPDR
NDEEWLKHTLAEYKGRHEKPEFSYKPVDVSLIEPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaaaattattgttgtcggtggaggacttgccggtctaatggcaacaatt
aaagcagcagaacagggtgcacatgttgatttattctcaattgttcctgttaaacgctct
cattcagtttgtgcacagggcggaattaatggagcggtgaatactaaaggtgaaggagat
tccccatggattcactttgatgatacagtttatgggggggacttcttagctgatcaacct
cctgttcaaaaaatgacagaagcagcaccgaaaattattcacttactagaccgtatgggc
gttatgtttaatcgaacaaaagaaggtttattagacttccgtcgttttggtgggactttg
catcatagaacggcatttgctggtgcgacgactggccaacagttattatacgctttagat
gaacaagtgcgtagtttcgaagtggatggcttggtgactaaatatgaaggttgggaattt
ttaggcgtcgtaaaagatgatgagaatgccgcacgcggtatcgttgctcaaaatatcacc
acttctgaaattcaatcatttggttccgatgcagtcattatggcaacaggtgggcctggt
attatatttggtaaaacaactaattcaatgattaatacagggtcagcagcatctattgtt
tatcagcaaggggtcaaatacgcgaatggagaattcatccaaattcacccaacagcgatt
cctggtgatgataagttacgtttaatgagtgaatcagctcgtggtgaaggagggcgtatt
tggacgtataaagacggtaaaccttggtatttcttagaagagaaatatccagattacggt
aaccttgtgccgcgtgacattgcgactcgtgaaattttcgatgtctgtgttaatcaaaaa
ttaggtattaacggtgaaaacatggtctatcttgacttatctcataaagatccacatgaa
ttagatgttaaattaggtggtattattgagatttatgaaaaattcacaggtgatgatcca
cgtaaagtgccgatgaaaatcttcccagcagtccactattcaatgggtggtttatatgtt
gattacgatcaaatgacgaacattgaaggtttattcgctgctggagagtgtgatttctct
caacacggtggtaaccgtttaggtgcgaattcactactgtcagcaatatatggtggtagt
gttgcaggtccaaatgccgtaaaatatgttgaaaatatcgagaaatcttatgttgattta
gatgaagatatatatcgtaaacgtgaagatgaagagcaagagcgatttgatcaattgctt
aacatgaaaggaactgaaaatgcctacaaacttcatcgcgaactaggagaaatcatgact
gctaatgtgacagtcgttcgacacaatgagaaattacttgaaactgacaaaaaaatcgtt
gaattaatgaagcgttatgaagatattgatatggaagatacttcacaatggagtaaccaa
gctgtattctttacacgtcaattatggaacatgcttgtgttagcacgtgttattacgatt
ggagcatataaccgtaacgaatcacgtggtgcacactataagccagaatttcctgatcgt
aacgatgaagaatggttaaaacatacattagctgaatacaaagggcgccacgaaaagcca
gaattcagctacaaacctgtcgatgttagcttaatcgaacctcgtaaacgtgactacaca
agtaagtcaaaagggggtaaaaaataa

DBGET integrated database retrieval system