KEGG   Shewanella frigidimarina: Sfri_2550Help
Entry
Sfri_2550         CDS       T00395                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00473  D-Alanine metabolism
sfr00550  Peptidoglycan biosynthesis
sfr01100  Metabolic pathways
sfr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sfri_2550
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sfri_2550
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Sfri_2550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfr01011]
    Sfri_2550
Enzymes [BR:sfr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sfri_2550
Peptidoglycan biosynthesis and degradation proteins [BR:sfr01011]
 Precursor biosynthesis
  Amino acid ligase
   Sfri_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ABI72392
UniProt: Q080C3
LinkDB All DBs
Position
3055342..3056352
Genome map
AA seq 336 aa AA seqDB search
MPKINLLLLCGGGGAEHDISLMSARFFESSLAKSDKFSVLKLVLDKHGHYHTEDGKLCDL
TNRREIRFEDNSTPAWSVDYVIPCIHGFPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGVPNTPYIFLHQLDDDAIKQTETAFDNWGSVFVKAASQGSSVGCYKVDVK
ANIANVLKDAFSYAPYVVVEQTIHARELEVAVYQYQGEVVATLPGEIICDSNTFYSFDEK
YATNSKARTDVVADNLSPEISQLIRDYAVKAFKGMKLRHLSRIDFFLTADNQILLNEINT
FPGLTPISMFPKMLQNHGHNFTEYLIDVIGQQVDLT
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagattaatctgctgttattgtgcggcggtggcggtgcagagcacgatatttcg
ttaatgtctgcacgtttttttgagtcatcactggcaaagtcagataaattttcggtactt
aagttagtactcgataaacatggtcattaccacactgaagacggtaaattatgcgacctg
actaatcgtcgtgaaattcgttttgaagataacagtacaccagcatggtcagttgattat
gtgatcccgtgtattcatggtttcccgggtgaaaccggcgatattcaatcatactttaac
ttaatacaactgccctactttggttgtgaatctgaagcctcaagtaattgttttaacaaa
atcaccgctaaaatgtggttttcagctttaggcgtcccaaacacgccttacatcttttta
catcaactagatgatgatgcaatcaagcaaactgaaacggcatttgataattggggatct
gttttcgttaaagcagcatcacaaggatcgtctgtgggatgctataaagtcgatgtgaaa
gccaatatcgctaacgtacttaaggatgcattcagttatgcaccttacgttgtggttgag
caaaccatccatgcgcgtgaattagaggtcgccgtatatcaataccagggtgaagtggtc
gctaccttaccgggtgagattatttgcgacagtaataccttttattcatttgatgaaaag
tacgctacaaatagtaaggctcgcaccgacgttgttgctgataacctaagcccagagatc
agtcagctgatccgtgattacgcggtaaaagcctttaaagggatgaagttacgtcacttg
tcgcgcatcgatttctttttaactgccgataaccaaattctcttgaatgaaattaacacc
ttccctgggttaacgcctatttcaatgttcccgaaaatgttgcaaaaccatggacataat
ttcactgaatatttaattgatgtgattggacaacaggttgatttaacgtaa

DBGET integrated database retrieval system