KEGG   Serratia fonticola DSM 4576: WN53_06580
Entry
WN53_06580        CDS       T04030                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00052  Galactose metabolism
sfw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    WN53_06580
Enzymes [BR:sfw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     WN53_06580
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C Methyltransf_31 MTS TrkA_N 2-Hacid_dh_C Methyltransf_25 Shikimate_DH 3HCDH_N Sacchrp_dh_NADP PglD_N ELFV_dehydrog PrmA Met_10 ThiF
Other DBs
NCBI-ProteinID: AKG68824
UniProt: A0A0F7H9H1
LinkDB
Position
1485634..1486683
AA seq 349 aa
MQSVVIHTEGEVRVEERPAPAIEAADEVLVRVAYSGLCGSDIPRIFAKGAHFYPITLGHE
FSGRVVTCGDRVTDLQQHDAVACVPLLPCFNCPECQRHYYSLCKHYQFVGSRSHGGNAEF
IVVKRANLVKLPANVSLLQGAFIEPITVGLHAIQLAGGCQGKEVIIIGAGTIGQLAIQCA
RAMGARSVTAIDINDDRLKLARQIGAENAFNSAELSPSEIAERLQERRFDQLILETAGTP
QTVGLALDIAGPRAQIALVGTLHKDLHLSYSTFSQILRKELTLLGSWMNYSAPWPGEEWQ
QAMKLFQSADLALEPLIASIDRPQQYAASVAALAGKPMQGKIMLKLCEE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcaatcagtcgtgatccatacggagggagaagtgcgcgttgaagaacgccccgctcct
gctattgaggccgccgatgaggtgttggttcgggtggcgtattccgggctatgcggttca
gatatcccccgcatcttcgccaaaggcgcgcatttctacccgattaccctggggcatgag
ttcagtggccgggtcgtgacctgcggcgatcgggttaccgacctgcaacagcatgatgcc
gtggcctgcgtccctttgctgccgtgctttaactgcccggaatgccagcgccattactat
tcgctgtgcaagcattaccagttcgtcggttcacgcagccacggcggcaacgccgagttt
atcgtggtcaaacgcgccaatctggtgaaattgcctgccaacgtcagcttgttgcagggg
gcgtttattgagcccatcaccgtcggcctgcatgccattcagttggctgggggctgccaa
ggcaaagaggtgatcatcattggtgccggcaccatcggccaactggcgatccaatgtgcc
cgcgcgatgggcgcacgcagcgtcacggcgatcgatatcaatgacgaccggctcaagctg
gcacggcagatcggtgcagaaaacgcgtttaacagcgcggagcttagcccctcagagata
gccgaacgcttgcaggaaaggcgctttgatcagctgattctggaaaccgctggcacgcca
caaacggtcgggctggcattggatatcgccgggccacgggcacaaatcgcgctggtgggg
acgctgcataaagatctgcatctgtcttacagcacctttagccagatcctgcgtaaggag
ctgacgctgctgggcagttggatgaactattcagccccgtggccaggggaagagtggcag
caggccatgaagctgttccaatcggcagatctggctctggagccgttgattgccagcatc
gatcgcccgcagcaatacgccgccagcgttgcagccctggccggtaagccgatgcaggga
aaaatcatgctcaaactctgcgaagagtga

DBGET integrated database retrieval system