KEGG   Streptomyces globisporus: WQO_15215Help
Entry
WQO_15215         CDS       T04209                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sgb  Streptomyces globisporus
Pathway
sgb00250  Alanine, aspartate and glutamate metabolism
sgb00410  beta-Alanine metabolism
sgb00430  Taurine and hypotaurine metabolism
sgb00650  Butanoate metabolism
sgb01100  Metabolic pathways
sgb01110  Biosynthesis of secondary metabolites
sgb01120  Microbial metabolism in diverse environments
sgb02024  Quorum sensing
Module
sgb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sgb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    WQO_15215
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WQO_15215
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WQO_15215
   00430 Taurine and hypotaurine metabolism
    WQO_15215
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    WQO_15215
Enzymes [BR:sgb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     WQO_15215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALU94572
UniProt: A0A0U3LE17
LinkDB All DBs
Position
3533998..3535425
Genome map
AA seq 475 aa AA seqDB search
MPLHRGAHPDQDEPSDERRRLALNPFFGEADPTAAMNTAPPRHRLPDGPLPPLTAYRLVH
DELMLDGNSRLNLATFVTTWMEPQAGVLMGECRDKNMIDKDEYPRTAELEKRCVAMLADL
WNAPDPSAAVGCSTTGSSEACMLAGLALKRRWAKRNADRYPATARPNLVMGVNVQVCWEK
FCNFWEVEARQVPMEGGRFHIDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALD
ALQERTGLDVPVHVDGASGAMVAPFLDPDLVWDFRLPRVASVNTSGHKYGLVYPGVGWAL
WRTADELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGRDGYRAVQQASRD
VACSLARAVEDLGDFRLLTRGDELPVFAFTTTAEVHAYDVFDVSRRLRERGWLVPAYTFP
ANRQDLSVLRVVCRNGFSSDLAELLVEDLKQFLPELRAQKHPVSHDRKAVTAFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccaccgtggtgcccacccggaccaggacgaaccctccgacgagcggcgcagg
ctcgccctgaacccgttcttcggcgaggcggacccgacggccgcgatgaacaccgcgccg
ccccggcaccggctgcccgacgggccgctgccgccgctgacggcgtaccggctggtccac
gacgagctgatgctcgacggcaactcccggctcaacctggccacgttcgtcaccacctgg
atggagccgcaggccggcgtcctgatgggcgagtgccgggacaagaacatgatcgacaag
gacgagtacccgcgcaccgccgagctggagaagcgctgtgtggcgatgctcgccgacctg
tggaacgcgcccgatccgtcggcggccgtggggtgttcgaccaccgggtcgagcgaggcg
tgcatgctcgcggggctcgccctgaagcggcgctgggccaagcggaacgcggaccgctat
ccggcgacggcacggcccaatctggtgatgggcgtgaacgtgcaggtctgctgggagaag
ttctgcaacttctgggaggtggaggcccggcaggtcccgatggagggcgggcgcttccac
atcgacccgcaggccgccgccgaactctgcgacgagaacaccatcggggtcgtcggcatc
ctcggctccaccttcgacgggtcctacgagccgatcgccgacctctgcgcggccctggac
gccctccaggagcgcacaggacttgatgtccccgtccatgtggacggggcgtccggcgcg
atggtggcgccgttcctcgacccggacctggtgtgggacttccggctgccgagagtggcg
tcggtcaacacctcgggccacaagtacggcctggtctatccgggggtcggctgggcgctg
tggcggacggcggacgagctgccggaggagctggtcttccgggtcaactacctgggcggc
gacatgccgacgttcgccctgaacttctcccggccaggggcgcaggtggtcgcgcagtac
tacacgttcctgcggctcgggcgcgacggctaccgggcggtccagcaggcgtcccgggac
gtggcctgctccctggcccgcgcggtggaggacctcggcgacttccgactcctcacccga
ggggatgagttgccggtgttcgccttcacgacgaccgccgaggtccacgcgtacgacgtc
ttcgacgtgtcgcgccggctgcgggagcgcggctggctggtgccggcgtacaccttcccc
gccaaccggcaggatctgtcggtgctgcgggtggtgtgccgcaacggtttctcctcggat
ctggccgagctgctggtcgaggacctgaagcagttcctgcccgaactgcgggcgcagaag
cacccggtgagccacgaccggaaggccgttacggcctttcaccactga

DBGET integrated database retrieval system