KEGG   Streptomyces globisporus: WQO_21795Help
Entry
WQO_21795         CDS       T04209                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sgb  Streptomyces globisporus
Pathway
sgb00564  Glycerophospholipid metabolism
sgb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    WQO_21795
Enzymes [BR:sgb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     WQO_21795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: ALU95715
UniProt: A0A0U3M1I8
LinkDB All DBs
Position
4918236..4919942
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERTLALAAMAERELDVLVVGAGVVGAGTALDAATRGLTTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSVSSGHGRGLPVHRHLSRKHALRVAPALKKDALVGALQYYDAQMDDARF
VTELVRTAASYGAHVANQARVVGFLREGERVVGALVRDVESGTEYEIRAKQVVNATGVWT
DDTQGLIGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLNTPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAACVTEDTPLLGAEGYKAL
WNARARIAARTGLHVARVEHLLNRYGSMTEEILELILADPTLGEPLPAADDYLRAEIVYA
ASHEGARHLEDVLTRRTRISIETFDRGARSARLCAELIAPVLGWDQGRIDREVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVST
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgccgagcgcaccctcgcgctcgccgccatggccgag
cgcgaactggacgtgctggtcgtgggggcgggcgtggtcggcgcgggcacggcgctggac
gccgccaccagaggcctgacgaccggcctggtcgaggcgcgcgactgggcgtccggcaca
tcgagcaggtcgagcaagctgatccacggcggcctgcgctatctggagatgctcgacttc
gccctggtccgggaggcgctcaaggagcgcgggctgctcctggaacggctcgccccgcat
ctggtgaagcccgtgcccttcctctaccccttgcagcacaagggctgggagcgcctctac
gccggctccggcgtcgcgctgtacgacgcgatgtcggtctcctccggccacggacgcggc
ctccccgtccaccgccacctctcccgcaagcacgccctgcgggtcgcccccgcgctgaag
aaggacgccctggtcggcgccctccagtactacgacgcccagatggacgacgcccgcttc
gtcaccgagctggtgcgcaccgccgcgtcctacggcgcccacgtggccaaccaggcccgg
gtcgtcggcttcctccgtgagggcgagcgggtcgtcggcgcgctcgtccgggacgtcgag
agcggcacggagtacgagatccgggccaagcaggtggtcaacgccaccggcgtgtggacc
gacgacacccaggggctcatcggcgagcgcggacagttccacgtccgggcctccaagggc
atccacctggtcgtccccaaggaccgcatccactcctccaccggcctcatcctgcgcact
gagaagtccgtcctcttcgtcatcccctggggccggcactggatcatcggcaccacggac
accgactgggacctggacaaggcccacccggccgcctccagcgccgatatcgactacctc
ctggagcacgtgaactccgtcctgaacaccccgctgaccagggatgacgtccagggcgtc
tacgccgggctgcgcccgctgctggcgggcgagtcggacgccaccagcaagctgtcgcgc
gagcacaccgtggcccaccccgcccccggcctggtcgtcgtggcgggcggcaagtacacg
acgtaccgggtcatggccaaggacgcggtggacgaggcggtgcacgggctcgaccagcgg
gtcgcggcctgcgtcaccgaggacaccccgctgctgggggccgaggggtacaaggccctg
tggaacgcgcgcgcccggatcgcggcccgcaccggactccatgtcgcccgggtggagcat
ctgctcaaccggtacggctcaatgaccgaggagattctggaactgatcctcgccgacccc
accctgggcgaaccgctgcccgccgccgacgactatctgcgcgccgagatcgtctacgcg
gcctcccacgagggcgcccgccatctggaggacgtgctgacccggcgcacccggatctcc
atcgagaccttcgaccggggcgcccgcagcgcccggctctgcgcggagctgatcgcgccg
gtgctgggctgggaccagggccgcatcgaccgggaggtcgagcactacgagaagcgggtg
gaggccgagcgcgagtcgcagcggcagcccgacgacctcacggccgacgcggcccggctc
ggcgcaccggacatcgtgtccacctga

DBGET integrated database retrieval system