KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00010
Entry
SGGBAA2069_p00010 CDS       T01444                                 

Gene name
xerC
Definition
(GenBank) Tyrosine recombinase xerC
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Phage_int_SAM_1 TrmB
Other DBs
NCBI-ProteinID: CBZ49482
LinkDB
Position
pSGG1:complement(253..1371)
AA seq 372 aa
MSKLEAKGRDILRKQYYERSKVAREAIKLENGRHAVYNTISSKNSLRQHESQWRQFATYA
SEKYNVKGLKKLDKGMVASYLNELKAQGVAEKTLKSRVSAINHVMVGSGVWKSNQKVSLT
DLRAKGAVSHEKGDRRVYKPLTGKEWREANKEAYRANMELVDLSRAFGLRRSEIFGKAGS
SYKGLTFRNLGHVEGSKRLFAEVIGKGGKYRVVPVLEAFKGQMWARYGAQSRTYPKNYFQ
KPTEERARLLKSSLKSKERLFQTNKSNVPLHINRNEYVERMLKERQKHYEKSQGKLTPDK
KRVGYSRIRFRELENGRLELFKVDYKNGQRVISAVQPFDVIKVATFEGYALAAADVMRAV
GHNRLDVLQTYL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcaaaactggaagcaaaaggacgggatattttacgcaaacagtattatgagcgctca
aaggtcgctagagaagctattaagctcgaaaatgggcgtcatgcggtctataatacgatt
tcaagcaaaaatagcctgcgacagcacgaatcgcaatggcgccagtttgccacgtatgca
agcgaaaaatacaatgttaaagggcttaaaaagcttgataaaggcatggttgcgagctat
ttaaacgagttgaaagcccaaggcgtagctgaaaagaccctaaaatcaagggtttcagct
atcaatcatgtcatggtggggtctggcgtttggaagagcaatcagaaagtttcgttgact
gatttaagagctaaaggcgctgtgagccacgagaagggggatagacgcgtttataagcct
ctgactggtaaagagtggcgggaagcaaataaagaggcttacagggcgaatatggagctt
gtagacctatctcgagcttttggacttcgtcggagcgaaatttttggcaaggcagggagt
agctataaagggttaacttttcgtaatttggggcacgtagaaggctctaagaggctgttt
gcggaagttatcggtaaaggtggtaaatatcgtgttgttcctgttttagaggcttttaag
gggcaaatgtgggcgagatacggcgcacagagccgaacttaccccaaaaattactttcaa
aaacccactgaagagcgggctcgactcttaaaatcaagtctcaaatcaaaagaacggctc
tttcaaaccaataaaagcaacgttcccttgcatatcaaccgcaacgaatacgtggaacgg
atgcttaaagaacgtcagaaacactatgaaaagtcgcaagggaagctaactccagacaaa
aaacgggttggttatagtcgtattcgctttcgagaactggaaaatgggcgcttagaactc
tttaaggtcgattataagaacggacagcgagtcatttcagcagttcaaccgttcgacgtt
attaaagtagccacttttgaaggctacgccttagcagctgccgatgttatgcgagcagtc
ggtcataatcgattggacgttttgcagacgtatttgtaa

DBGET integrated database retrieval system