KEGG   Sinocyclocheilus grahami: 107553529Help
Entry
107553529         CDS       T04918                                 

Definition
(RefSeq) guanidinoacetate N-methyltransferase-like
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00260  Glycine, serine and threonine metabolism
sgh00330  Arginine and proline metabolism
sgh01100  Metabolic pathways
Module
sgh_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107553529
   00330 Arginine and proline metabolism
    107553529
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     107553529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 107553529
NCBI-ProteinID: XP_016091276
LinkDB All DBs
Position
Unknown
AA seq 233 aa AA seqDB search
MTTAQPIFSKGENCKQVWHDASADYNESDTHLEIMGKPVMERWETPYMHSLATVAASKGG
RVLEIGFGMAIAATKVESFPIEEHWIIECNDGVFQRLQEWAKSQPHKIVPLKGLWEDVVP
TLPNNHFDGILYDTYPLSEETWHTHQFNFIKGHANRLLKPGGVLTYCNLTSWGELLKNKY
NHIDKMFQETQVPHLLEAGFKKEKISTALMDISPPSECKYYSFNKMITPTIVK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgcgcagccgatcttctcaaagggcgaaaactgcaaacaagtgtggcacgac
gcgagtgctgactacaacgagtccgacacacacttggagatcatggggaaacccgttatg
gagcgctgggaaactccatatatgcactctcttgcaacagttgctgcatctaaaggtgga
agggtgcttgagatcggctttgggatggccatagcagccactaaagtggagtctttccct
attgaggagcactggatcattgagtgcaatgacggtgtattccagaggctacaggaatgg
gccaaaagtcagccacataaaattgttcctctgaaaggcctgtgggaagatgtggtgcca
accctacccaacaatcactttgatggtattctttatgacacatatcctttgtcagaggag
acctggcacacacatcagttcaacttcatcaagggtcatgctaacagactgctgaagcct
ggcggtgtgctcacgtactgtaatctcacttcctggggtgagctgctgaaaaacaaatat
aaccacatcgacaaaatgttccaggagacacaagttccccacctgctggaagctggattc
aaaaaggagaagatcagcaccgcactgatggacatcagtcctcccagtgaatgcaaatac
tattcctttaataagatgatcacaccaactattgttaaataa

DBGET integrated database retrieval system