KEGG   Streptomyces griseus: SGR_2753Help
Entry
SGR_2753          CDS       T00691                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sgr  Streptomyces griseus
Pathway
sgr00564  Glycerophospholipid metabolism
sgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SGR_2753
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SGR_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: BAG19582
Kitasato: SGR2753
UniProt: B1W3S6
LinkDB All DBs
Position
complement(3263373..3265079)
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERTAALAAMAERELDVLVVGAGVVGAGTALDAATRGLTTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSVSSGHGRGLPVHRHLSRKHALRVAPALKKDALVGALQYYDAQMDDARF
VTELVRTAASYGAQVANAARVVGFLREGERVVGALVRDVESGTEYEIRAKQVVNATGVWT
DDTQGLIGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLQHVNSVLNTPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAACVTEDTPLLGAEGYKAL
WNARARIAARTGLHVARVEHLLNRYGSMTEEILELILADPTLGEPLPAADDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSARLCAELMAPVLGWDEGRIDREVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgccgagcgcaccgccgcgctcgccgccatggccgag
cgcgaactggacgtgctggtcgtgggggcgggcgtggtcggcgcgggcacggcgctggac
gcggccaccagaggcctgacgaccgggctggtcgaggcgcgcgactgggcgtccggcaca
tcgagcaggtcgagcaagctgatccacggcggcctgcgctatctggagatgctcgacttc
gccctggtccgggaggccctcaaggagcgcgggctgctgttggagcggctcgccccccac
ctggtgaagcccgtgcccttcctctaccccttgcagcacaagggctgggagcggctctac
gcaggctccggcgtcgcgctgtacgacgcgatgtcggtctcatcgggccatgggcgaggc
ctccccgtccaccgccacctctcccgcaagcacgccctgcgggtcgcccccgcgctgaag
aaggacgccctggtcggcgccctccagtactacgacgcccagatggacgacgcccgcttc
gtcaccgagctggtgcgcaccgccgcgtcctacggggcccaggtggcgaacgccgcccgt
gtggtcggcttcctccgcgagggcgagcgggtcgtcggcgcgctcgtacgggacgtcgag
agcggcacggagtacgagatccgggccaagcaggtggtcaacgccaccggcgtgtggacc
gacgacacccaggggctcatcggcgagcgcggacagttccacgtccgggcctccaagggc
atccacctggtcgtccccaaggaccgcatccactcctccaccggactcatcctgcgcacg
gagaagtccgtcctcttcgtcatcccctggggccggcactggatcatcggcaccaccgac
accgactgggacctggacaaggcccacccggccgcctccagcgccgatatcgactacctc
ctccagcacgtcaactccgtcctcaacacccccctgaccagggacgacgtccagggcgtc
tacgccggactgcgaccgctgctggccggcgagtcggacgccaccagcaagctgtcgcgc
gagcacacggtggcgcaccccgcccccggtctggtcgtcgtggcgggcggcaagtacacg
acgtaccgggtcatggccaaggacgcggtggacgaggcggtccacggactcgaccagcgg
gtcgccgcgtgcgtcaccgaggacaccccgctgctgggggccgagggctacaaggccctg
tggaacgcgcgcgcccggatcgcggcccggaccggactccatgtcgcccgggtggagcac
ctgctcaaccggtacggctcaatgaccgaggaaatcctggaactgatcctcgccgacccc
accctgggcgaacccctgcccgccgccgacgactacctgcgcgccgagatcgtctacgcg
gcctcccacgagggcgcccgccatctggacgacgtgctgacccggcgcacccggatctcc
atcgagaccttcgaccggggcacccgcagtgcccggctctgcgcggagctgatggcgccg
gtgctgggctgggacgaggggcggatcgaccgggaggtcgagcactacgagaagcgggtg
gaggccgaacgcgaatcgcagcggcagcccgacgacctcacggcggacgcggcccggctc
ggcgcaccggacatcgtgccgatctag

DBGET integrated database retrieval system