KEGG   Streptomyces griseus: SGR_4077Help
Entry
SGR_4077          CDS       T00691                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sgr  Streptomyces griseus
Pathway
sgr00250  Alanine, aspartate and glutamate metabolism
sgr00410  beta-Alanine metabolism
sgr00430  Taurine and hypotaurine metabolism
sgr00650  Butanoate metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr02024  Quorum sensing
Module
sgr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SGR_4077
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGR_4077
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_4077
   00430 Taurine and hypotaurine metabolism
    SGR_4077
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SGR_4077
Enzymes [BR:sgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SGR_4077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAG20906
Kitasato: SGR4077
UniProt: B1VSF2
LinkDB All DBs
Position
complement(4768944..4770371)
Genome map
AA seq 475 aa AA seqDB search
MPLHRGAHPEQDEPSEERRRLALNPFFGEADPTAAMNTAPPRHRLPDGPLPPLTAYRLVH
DELMLDGNSRLNLATFVTTWMEPQAGVLMGECRDKNMIDKDEYPRTAELERRCVAMLADL
WNAPDPRAAVGCSTTGSSEACMLAGLALKRRWAKRNADRYPATARPNLVMGVNVQVCWEK
FCDFWEVEARLVPMEGERFHLDPAAAAELCDENTIGVVGILGSTFDGSYEPIAELCAALD
AFQKRTGLDVPVHVDGASGAMVAPFLDPDLVWDFRLPRVASINTSGHKYGLVYPGVGWAL
WRTADALPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGHEGYRAVQQASRD
VACALARAIEELGDFRLLTRGDELPVFAFTTNDDVHAYDVFDVSRRLRERGWLVPAYTFP
ANRQDLSVLRVVCRNGFSSDLAELLIEDLKLLLPELRSQKHPLSHDRAVPTAFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccaccgcggtgcccacccggaacaggacgaaccctccgaggagcggcgcagg
ctcgccctgaacccgttcttcggcgaggccgacccgacggccgcgatgaacaccgcgccg
ccccggcaccggctgcccgacgggccgctgccgccgctgacggcgtaccggctggtccac
gacgagctgatgctcgacgggaactcccggctcaacctggccacgttcgtcaccacgtgg
atggagccgcaggccggcgtcctgatgggcgagtgccgggacaagaacatgatcgacaag
gacgagtacccgcgcaccgccgagctggagcggcgctgtgtggcgatgctcgcggacctg
tggaacgcccccgacccgagggcggccgtggggtgttcgaccaccgggtcgagcgaggcg
tgcatgctcgcggggctggccctgaagcggcgctgggcgaagcggaacgcggaccgctat
ccggcgacggcccggcccaatctggtgatgggcgtcaacgtgcaggtctgctgggagaag
ttctgcgacttctgggaggtggaggcccggctcgtcccgatggagggcgagcggttccac
ctcgacccggctgccgccgccgagctgtgcgacgagaacaccatcggggtcgtcggcatc
ctcggctccaccttcgacgggtcctacgagccgatcgccgagctgtgcgcggccctggac
gcgttccagaagcggaccggcctcgacgtgcccgtccatgtggacggggcgtcgggcgcg
atggtggcgcccttcctcgacccggacctggtctgggacttccggctgccgagggtggcg
tcgatcaacacctcgggccacaagtacggcctcgtctacccgggggtcggctgggcgctg
tggcgcacggcggacgcgctgcccgaggagctggtcttccgggtcaactacctgggcggc
gacatgccgacgttcgcgctgaacttctcccggcccggggcgcaggtggtcgcgcagtac
tacacgttcctgcgcctcgggcacgagggctaccgcgcggtccagcaggcctcccgggac
gtggcgtgcgcgctggcccgggcgatcgaggagctgggcgacttccggctgctcacccgg
ggcgacgagctgccggtgttcgccttcacgacgaacgacgacgtccacgcgtacgacgtg
ttcgacgtgtcacgccggctgcgggagcgcggctggctggtgccggcctacaccttcccc
gccaaccggcaggacctgtcggtgctgcgcgtggtgtgccgcaacgggttctcctcggac
ctggccgagctgctgatcgaggacctgaagctcctgcttcccgaactccgctcccagaag
cacccgttgagccacgaccgggcggtaccgacggccttccaccactga

DBGET integrated database retrieval system