KEGG   Streptomyces glaucescens: SGLAU_01170
Entry
SGLAU_01170       CDS       T03327                                 

Gene name
strK
Definition
(GenBank) putative streptomycin-6-phosphate phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00521  Streptomycin biosynthesis
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGLAU_01170 (strK)
Enzymes [BR:sgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     SGLAU_01170 (strK)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-ProteinID: AIR96262
UniProt: A0A089WXW5
LinkDB
Position
289312..290700
AA seq 462 aa
MTAVIPGTGRAARRSARRWGGVAAALVTALTVTSAAPAPRIGVTGTEPARPRNVILLVGD
GMGDSEITAARNYTVGAGGRLAMDRLPMTGSSLTYAVDERGRPDYVTDSAAGATAWATGH
KTVNGRVAKTPGTDRPLPTLLELARRQGYATGSVTTARLTDATPAALTAHVTDRSCAGPA
DMAACPADAKERGGAGSIAEQTVALRPDVLLGGGADVFGQRITAGPHRGRTVLERARAEG
YQVVRDRTGLRAARPDRPVLGLFADGPLPVEWTGVPARPGGTAPQRCGTGAPAHPAGTPS
LEESTRAALELLTARARRAGAAAGGFFLQVEGAAIDDRAHDADPCGQIGETVAFDRAVGA
ALAYAARHPGTLVVVTADHGSGGQILPLEARPPGRSATLVTDEGAPLHLGYASGAPDDVQ
EHTGVPVRVAARGPYAERVVGVHENTALFHTVRTALGLRSIH
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgacggcagtcattcccgggaccggacgcgcggcgcggcggtccgcgcggcgctggggc
ggtgtcgccgcggcgctggtgacggcgctgaccgtgacctccgccgcccccgcaccccgc
atcggcgtgaccggcaccgaaccggcccgcccgcgcaacgtcatcctcctcgtcggtgac
ggcatgggcgactcggagatcaccgcggcgcgcaactacaccgtcggcgccggcgggcgg
ctcgccatggaccggctgccgatgaccggttcctccctcacctacgccgtggacgagcgg
ggccgccccgactacgtcaccgactccgcggccggcgccaccgcctgggccaccgggcac
aagacggtcaacgggcgggtcgccaagacccccggcaccgaccggccgttgcccacgctg
ctggagctggcccggcgtcagggctacgccaccggcagcgtcaccaccgcacgcctcacc
gacgcgacgcccgccgcgctcaccgcccacgtcaccgaccggtcctgcgcgggcccggca
gacatggcggcctgcccggcggacgccaaggagcgcgggggcgcgggctccatcgcggaa
cagaccgtggcgctgcgcccggacgtgctgctcggcggcggcgcggacgtgttcgggcag
cggatcacggccggcccgcaccgggggcggaccgtcctggagcgggcccgggccgagggc
taccaggtggtgcgggaccgtaccggtctgcgggccgcccgcccggaccgcccggtcctc
gggctgttcgccgacgggccgctgccggtcgagtggaccggggtcccggcccggcccggc
ggcaccgccccccagcgctgcggcaccggtgctcccgcgcacccggccggcacgccgagc
ctggaggagtcgacgcgggccgcgctggaactgctgacggcccgtgcgcggcgggccggc
gccgccgccggggggttcttcctgcaggtggagggagccgccatcgacgaccgggctcac
gacgccgacccgtgcggccagatcggggagaccgtcgccttcgaccgtgccgtcggggca
gcgctggcctatgcggcacgccatcccggcacgctcgtcgtcgtgacggcggaccacggc
agcggcgggcagatcctgccgctggaggcccggccgccgggccggtccgcgacgctcgtc
accgacgagggagcgcccctgcatctcggctacgccagcggcgcgccggacgacgtgcag
gagcacaccggggtgccggtccgggtcgccgcccgcgggccgtacgcggagcgggtcgtc
ggcgtgcacgagaacaccgcgctgttccacaccgtgcgcaccgcgctcggcctgcgctcc
attcactag

DBGET integrated database retrieval system