KEGG   Shewanella sp. MR-4: Shewmr4_0800Help
Entry
Shewmr4_0800      CDS       T00388                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
she  Shewanella sp. MR-4
Brite
KEGG Orthology (KO) [BR:she00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Shewmr4_0800
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Shewmr4_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored Glutaredoxin DAO NAD_binding_7 Thi4 AlaDh_PNT_C K_oxygenase NAD_binding_8 Spermine_synth FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABI37880
LinkDB All DBs
Position
complement(934744..936321)
Genome map
AA seq 525 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESRKSQELTSLANDIVSLSTLVSLKEAQGPRT
PAMTVVNPELNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDEIIEQIRNLPGKYEFE
TYVSLTCQNCPDVIQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGVVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELE
LASGAKLRSRTILLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVDG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSVPGVFAA
GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSTETTATKAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtcagcagatgaaagcagaaagtctcaagaattaacaagcttagcc
aatgacatcgttagcctttcaacattagtgagcctcaaagaagctcaaggcccccgcacg
ccagcgatgacagtggttaacccagaactcaatactcagattagctttgctggtctgcct
atgggtcacgaatttacctcactcgtgttagccctgctgcacacgggtggacaccccatc
aaactcagcgacgaaattattgagcagatccgtaatctgcctggcaaatatgagtttgaa
acctatgtgtcactcacctgccaaaactgccctgatgtgattcaggcgctgaatatgatg
gcggcgattaacccgaacatcaccaacgtgatgatcgacggcgccctgttccaagatgaa
gttgccagtcgcaatatcatggccgtaccgtctgtgtacttgaacggtgaagtctttgcc
gcgggtcgcatcagcattggtgagatcttaaacaaactcgatactggcgcggccagccgc
aaagcggaagaactcagccaaaaagccccatacgaagtcttagtcgtcggtggtggcccc
gcgggtgctgcggcagcgatttacgctgcccgtaaaggtctgcgtaccggtgtggtggcc
gataaattcggtggccaagtcgccgaaaccgttggcatcgaaaactttatttcggtaaaa
gcgactgaaggtccaaaactggtggcaaaccttgaagcccatgtgcgtgactacgaagtc
gatatcatggataaccaaaaagccgttaaactggcgagcgatggtttattcgaactcgaa
ctggcaagcggcgctaaactgcgcagccgtaccatactactggcaaccggtgcccgctgg
cgcgaaatgaatgtccccggcgagaaagaataccgcggtaaaggcgtagcctactgccca
cactgtgacggcccattatttaaaggcaaacgtgttgcagtgatcggtggcggtaactca
ggtatcgaagcggccatcgacttagccaacatcgttgagcatgtcacagtactcgagttc
gatagcaaactgcgcgccgatgatgtgctgcaacgtaaagcggcctctatgggtaacata
aaaatcattactcaggcgatgaccactgaagtaacaggtgacggtacccgtgtagacggc
ctgaactacaccgaccgtgcaacgggtgaaagccatcatatcgcgctggctggtatcttc
gtacaaatcggtttagtgcccaatgccgaatggttaaaaggcactgtggatttgactcct
cgcggcgaaatcattgtcgatgagcgcggccagacctcagtaccaggcgtatttgccgca
ggtgacgtgactaactcaccttacaagcaaatcatcatcgccatgggtagcggtgccaat
gcctcactgggtgcatttgattacttaattcgccatagcgatgacagtaccgaaaccaca
gcgactaaagcggcttaa

DBGET integrated database retrieval system