KEGG   Shewanella sp. MR-4: Shewmr4_2024Help
Entry
Shewmr4_2024      CDS       T00388                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
she  Shewanella sp. MR-4
Brite
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Shewmr4_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABI39097
LinkDB All DBs
Position
complement(2410509..2411021)
Genome map
AA seq 170 aa AA seqDB search
MKNIVLLLASMSAASAFADVSVPMNLVNEKGVGESVGQVTISESQYGVVFTPSLKGLMPG
LHGFHLHENGSCDPKEKDGKIVPAGAAGGHYDPAATKAHGTPWGEGHLGDLPPLFVDADG
AASQAVLAPRLKMGDLKGHAIMIHAGGDNHSDHPAPLGGGGARVACGIIN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcgtgttactgcttgcatcaatgtctgctgccagtgcatttgcagacgtg
agcgtgccaatgaatcttgtcaacgaaaagggcgtgggtgaaagtgtcggtcaagtgacc
atttcagagtcacagtatggagtggtatttacgccatcactcaaaggcttaatgccagga
ttacatggtttccatctacatgagaacggcagctgtgatccaaaggaaaaggacggaaaa
atcgtccctgctggcgcggcaggtggacactatgatcctgccgccacaaaagcccacggc
acgccatggggagaagggcatttaggcgatctgccaccattgtttgtcgatgcagacggt
gcagctagtcaggccgtgctggcaccgcgcttaaaaatgggtgatcttaaaggccatgcg
atcatgatccatgccggtggcgacaaccattccgatcacccagcgcctttaggtggcggc
ggtgcgcgtgtagcctgcggtattatcaattaa

DBGET integrated database retrieval system