KEGG   Shewanella sp. FDAARGOS_354: CEQ32_06110Help
Entry
CEQ32_06110       CDS       T04944                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shf  Shewanella sp. FDAARGOS_354
Pathway
shf00473  D-Alanine metabolism
shf00550  Peptidoglycan biosynthesis
shf01100  Metabolic pathways
shf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CEQ32_06110
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEQ32_06110
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CEQ32_06110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shf01011]
    CEQ32_06110
Enzymes [BR:shf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CEQ32_06110
Peptidoglycan biosynthesis and degradation proteins [BR:shf01011]
 Precursor biosynthesis
  Amino acid ligase
   CEQ32_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: ASF14623
UniProt: A0A1Z4A9Q2
LinkDB All DBs
Position
1343734..1344744
Genome map
AA seq 336 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLLSANYFETSLAKSEQFNVLRVVLDKFGQYQTAVGDNCEL
TNNREIRFRDESKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALENWGSIFVKAASQGSSVGCYKVDEA
SKVSEVLKDAFGYAPYVIVEKTIKARELEVAVYEYQGEVIATLPGEIICDSNTFYTFDEK
YAKNSKARTDVVAQNVPTEISDQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTQYLSLVINSQLAAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagatcaatttacttttgctgtgcggcggtggaagtgcggaacacgatatttcc
ctactgtcggctaattattttgaaacctcgttagcaaaatcagaacagttcaatgtacta
cgtgtggtactggataaatttggccaataccaaaccgccgtaggcgataactgcgagctg
accaataaccgtgagatccgctttcgtgacgagagcaaagccccttggcccgtggattat
gtgatcccttgtattcacggttacccaggtgagacgggtgatattcaatcttactttaat
cttattcaactgccctactttggctgcgaatccgaagcgagcagtaactgctttaacaag
atcaccgccaaaatgtggttcagcgccttaggcattcccaacacgccttatatcttttta
aatcaatacgatgatgaagctattgctcaaactcaagcggcacttgaaaattgggggtca
attttcgtaaaggctgcgtctcagggctcatcggtcggttgctataaggtggatgaggct
agcaaagtgagcgaagtactcaaagatgcctttggttatgcgccctacgtgattgttgaa
aaaaccattaaagcccgtgaacttgaagtcgcagtttacgaatatcaaggtgaagtgatc
gccaccctacccggcgaaatcatctgcgatagcaataccttctacaccttcgatgaaaag
tacgcgaaaaacagtaaggcccgaaccgatgtcgtcgcgcaaaatgtaccgactgaaatc
agcgatcagatccgagcctatgcgattaaagcctttaaaggcatgaagttacgtcacctg
tcccgtatcgactttttcttaaccgcggacaatgaaatcctgctgaacgaaatcaatacc
ttcccaggttcgacgcccatttcgatgttccctaagatgctgcaaaatcatgggcatgat
ttcacccaatacttaagtttagtgattaacagccagttagcggcaaagtaa

DBGET integrated database retrieval system