KEGG   Shewanella sp. FDAARGOS_354: CEQ32_11660Help
Entry
CEQ32_11660       CDS       T04944                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shf  Shewanella sp. FDAARGOS_354
Brite
KEGG Orthology (KO) [BR:shf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CEQ32_11660
Enzymes [BR:shf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CEQ32_11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO NAD_binding_7 Glutaredoxin Thi4 FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 Spermine_synth FMO-like
Motif
Other DBs
NCBI-ProteinID: ASF15564
UniProt: A0A1Z4AC84
LinkDB All DBs
Position
2578519..2580102
Genome map
AA seq 527 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLANDIVSLSSLVSLKEAQGSRT
PAMTVVNPELNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYEFE
TYVSLTCQNCPDVIQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGVVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELE
LASGAKLRSRTILLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSIPGVFAA
GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSTETKTTDTKAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtcagcagatgaaagcaagaagtctcaagaattaaaaagcttagcc
aatgacatcgttagcctttcctctttagtgagcctcaaagaagctcaaggctctcgtacg
cctgcgatgacagtggttaacccagaactcaatactcagattagctttgctggtctgcct
atgggtcacgaatttacctcactcgtgctagccctgctgcacacgggtggacacccaatc
aaactcagcgatgacatcatcgagcagatccgtaatctgcccggcaaatatgagtttgaa
acctatgtgtcactcacctgccaaaactgccctgatgtgattcaggcgctgaatatgatg
gccgcgatcaacccgaacattaccaacgtgatgatcgacggcgccctgttccaggatgaa
gtcgccagccgcaacatcatggccgtaccgtctgtgtacttaaacggcgaagtgtttgcc
gcgggtcgtatcagcatcggtgagatcttaaataaactcgatactggcgcagccagccgt
aaagcggaagaactcagccaaaaagccccatacgaagtcttagtcgttggcggcggccct
gctggcgctgcggcagcgatttatgccgcccgtaaaggtctacgtactggagtggtggcc
gataaattcggtggccaagtcgccgaaactgttggtatcgaaaactttatttcggttaaa
gcgactgaaggtccaaaactggtggcaaaccttgaagcccatgtgcgtgactacgaagtc
gatatcatggataaccaaaaagccgttaaactggcgagcgatggtttattcgagctcgag
ttagcaagcggcgcgaaactgcgcagccgtaccatactactggcaaccggtgcccgctgg
cgcgaaatgaacgtccccggcgagaaagaataccgcggtaaaggcgtagcctactgccca
cactgtgacggcccattatttaaaggcaaacgtgtagcggttatcggtggcggtaactca
ggtatcgaagcggccatcgacttagccaacatcgttgagcatgtcacagtactcgagttc
gacagcaaactgcgcgctgacgatgtactgcaacgtaaagcggcctctatgggtaacatc
aaaatcattactcaggcgatgaccacagaagtgacaggcgatggtactcgggtgaatggc
ctaaactacaccgaccgtgcaacaggtgaaagccaccatatcgcgctggcagggatcttc
gtacagatcggtttagtgcccaatgccgaatggttaaaaggcacagtggatttgactcct
cgcggcgaaatcatcgtcgatgagcgcggccaaacctctatcccaggcgtatttgccgca
ggtgacgtgactaactcaccttacaagcaaatcattatcgccatgggtagcggtgccaat
gcctcactgggtgcatttgattacttaattcgccatagcgatgacagtaccgaaaccaaa
accacagacaccaaagcggcttaa

DBGET integrated database retrieval system