KEGG   Shewanella sp. MR-7: Shewmr7_2205Help
Entry
Shewmr7_2205      CDS       T00389                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00473  D-Alanine metabolism
shm00550  Peptidoglycan biosynthesis
shm01100  Metabolic pathways
shm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Shewmr7_2205
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shewmr7_2205
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Shewmr7_2205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shm01011]
    Shewmr7_2205
Enzymes [BR:shm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Shewmr7_2205
Peptidoglycan biosynthesis and degradation proteins [BR:shm01011]
 Precursor biosynthesis
  Amino acid ligase
   Shewmr7_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABI43193
UniProt: Q0HUL2
LinkDB All DBs
Position
2610390..2611400
Genome map
AA seq 336 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLLSANYFETSLAKSEQVNVLRVVLDKFGQYQTAAGDDCEL
TNNREIRFRDETKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALENWGSIFVKAASQGSSVGCYKVDDS
SKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYQGEVVATLPGEIICDSNTFYTFDEK
YAKSSKARTDVVAQNVPADISDQIRAYAIKAFKGMKLRHLSRIDFFLTQDNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVIKGQLAAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatcaatttacttttgctgtgcggcggtggaagtgcggaacacgatatttcc
ctactgtcggctaattattttgaaacctcattagcaaaatccgagcaggttaatgtactg
cgcgtggtactggacaagtttggccaataccaaaccgccgcgggggatgactgtgagctg
accaataaccgtgaaattcgcttccgtgatgagactaaggcgccttggcctgtggattat
gtgatcccctgtattcacggctatccgggcgagacaggtgacattcagtcttacttcaat
cttatccaactgccctactttggttgcgaatccgaagccagcagcaactgctttaacaag
atcaccgctaagatgtggtttagtgccttaggcattcctaacacaccttatatcttctta
aatcaatatgatgatgaagcgattgcccaaacccaagccgcgctggaaaattggggttcg
attttcgtcaaggccgcatctcaaggttcttctgtgggttgctataaagtcgatgacagc
agcaaagtcgcaggcgtgttaaaagatgcctttggctatgcgccctatgtgattgtcgaa
aaaaccattaaagcccgtgagcttgaagtcgccgtttatgagtatcaaggcgaagtggtt
gcgaccctgccgggcgaaatcatctgcgatagcaataccttctacaccttcgatgaaaaa
tacgccaagagtagtaaggcccgcaccgatgtggtcgcgcaaaatgtgcccgctgacatc
agcgatcaaatccgcgcctatgcaattaaagcctttaagggcatgaagcttcgccatctg
tcacgcatcgactttttcttaacccaagataatgaaatcctgctcaacgaaatcaatacc
ttcccgggttcgacgccgatttcgatgttccctaagatgttgcaaaaccatgggcatgat
tttaccgaatacttaagtttggtgattaaaggccagttagcggctaagtga

DBGET integrated database retrieval system