KEGG   Shewanella sp. ANA-3: Shewana3_2307Help
Entry
Shewana3_2307     CDS       T00428                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00473  D-Alanine metabolism
shn00550  Peptidoglycan biosynthesis
shn01100  Metabolic pathways
shn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Shewana3_2307
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shewana3_2307
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Shewana3_2307
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shn01011]
    Shewana3_2307
Enzymes [BR:shn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Shewana3_2307
Peptidoglycan biosynthesis and degradation proteins [BR:shn01011]
 Precursor biosynthesis
  Amino acid ligase
   Shewana3_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ABK48536
UniProt: A0KXL7
LinkDB All DBs
Position
2772189..2773199
Genome map
AA seq 336 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLLSANYFETSLAKSEQFNVLRVVLDKFGQYQTAAGDDCEL
TNNREIRFRDETKPAWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQYDDDAIAQTQAALENWGSIFVKAASQGSSVGCYKVDDS
SKVADVLKDAFGYAPYVIVEKTIKARELEVAVYEYQGEVVATLPGEIICDSNTFYTFDEK
YAKSSKARTDVVAQNVPTDISEQIRAYAIKAFKGMKLRHLSRIDFFLTQDNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLAAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatcaatttacttttgctgtgcggcggtggaagtgcggaacacgatatttcc
ctactgtcggctaattattttgaaacctcattagcaaaatccgagcagtttaatgtactg
cgcgtggtactggataaatttggccaataccaaaccgccgcaggcgatgactgtgaactg
accaataaccgcgaaattcgcttccgtgatgagaccaagcccgcatggcctgtggattat
gtcattccttgtattcacggctatccgggggaaacgggcgacattcagtcttactttaat
cttatccaactgccctactttggttgcgaatccgaagccagcagcaactgctttaacaag
atcaccgctaagatgtggttcagcgccttaggcattcctaacacaccttatatcttctta
aatcaatacgatgatgacgcgattgcccaaacccaagcagcgctcgaaaactgggggtcg
attttcgttaaagccgcatcccaaggctcatcggtcggttgctataaagtcgatgacagc
agcaaagtggctgacgtgttaaaagatgcctttggctacgcgccctatgtgatcgtcgag
aaaaccattaaggcccgtgagctggaagtcgcggtctatgagtatcaaggcgaagtggtt
gcgaccctgccgggcgaaatcatctgtgatagcaataccttctacaccttcgatgagaaa
tacgccaagagcagtaaggcacgcaccgatgtggtcgcgcaaaatgtgccaactgacatt
agtgagcagatccgcgcctatgcgattaaagcctttaagggcatgaagctgcgccatctg
tcacgcatcgactttttcttaacccaagataatgaaattctactcaacgaaatcaatacc
ttcccgggttcgacgccgatttcaatgttccctaagatgttgcaaaaccatggtcatgat
tttaccgaatacttaagtttggtgattaacggccagttagcggctaagtga

DBGET integrated database retrieval system