KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_1037
Entry
SHJGH_1037        CDS       T02531                                 

Definition
(GenBank) aromatase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho01056  Biosynthesis of type II polyketide backbone
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
Module
sho_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SHJGH_1037
Enzymes [BR:sho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SHJGH_1037
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc UQCC3
Other DBs
NCBI-ProteinID: AGF60703
LinkDB
Position
1213856..1214806
AA seq 316 aa
MARRTVHRTEESTRIAAGAEVVRALIEDVEGWSHLHPTAVHAEYVERKGTESLIRQWALV
DERSVRHWLMRRWDKDDTIAFAHEPAAPPFAEVRGAWTFESVDGGAAVVVRMEHEFVLLE
EDAAAADRQREKLRQGSLAYLKTLKHAAENREDIRRRTLTFEDPLFIAGSVQDAYTYLLE
ADKWPQRMPHVAALTLEEPGPGVQFFDMDTSDPDGGHRHSTRSVRICLSPRLIVYKQIKL
PVLLTAHTGHWSFTEIPEGVIATTRHTATVKESALGVLGEGTTVQDARNYLRHVLTDNSM
SNLRLTKEYAEGRAGR
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcacgtcgcaccgttcaccgcaccgaggagagcacccgcatcgccgcgggcgcggag
gtggtccgggccctcatcgaggacgtcgagggctggtcgcatctgcatcccacggccgtg
cacgccgagtacgtggagcggaagggcaccgagagcctgatccggcaatgggcgctggtc
gacgagcggtcggtacggcactggctgatgcgccggtgggacaaggacgacacgatcgcc
ttcgcccacgaaccggccgccccgccgttcgccgaggtccggggcgcgtggacgttcgag
tccgtcgacggcggcgcggccgtggtggtccgcatggagcacgagttcgtcctccttgag
gaggacgccgcggcggccgaccggcagcgggagaagctgcggcaggggtccctggcctac
ctgaagaccctcaagcacgccgcggagaaccgggaggacatccgccgccgcacactgacc
ttcgaggatccgctgttcatcgccgggtcggtgcaggacgcgtacacctatctgctggag
gccgacaagtggccgcagcggatgccgcacgtggccgccctcaccctggaggagcccgga
cccggcgtgcagttcttcgacatggacacctccgacccggacggggggcaccggcactcc
acccgctcggtgcggatctgcctgtctccgcgcctgatcgtctacaagcagatcaagctg
ccggtcctgctgaccgcgcacaccgggcactggtccttcaccgagatcccggagggtgtc
atcgccaccacccggcacacggccacggtcaaggagtcggcgctcggagtgctcggcgag
ggcacgaccgtccaggacgcccggaactacctgcgtcacgtactgaccgacaacagcatg
agcaacctgcggctcaccaaggagtacgcggaggggcgtgcgggccggtga

DBGET integrated database retrieval system