KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5632Help
Entry
SHJGH_5632        CDS       T02531                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00564  Glycerophospholipid metabolism
sho01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SHJGH_5632
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SHJGH_5632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AGF65295
LinkDB All DBs
Position
6370663..6372318
Genome map
AA seq 551 aa AA seqDB search
MAERELDVLVVGGGVVGAGTALDAVTRGLSTGLVEARDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLYAGSGVALYDAMSMARGH
GRGLPVHRHLTRRHALRVAPCLKKDALVGALQYYDAQMDDARFVATLVRTAASYGAKVAN
RARVTGFLREGERVVGARVQDVEAGGEYEIHAQQVVNATGVWTDDTQAMVGERGRFHVRA
SKGIHLVVPKDRVHSTTGLILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADI
DYLLEHVNSVLAVPLSRDDVQGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDEAVHGLDMRVADCVTEETPLLGAEGYQALWNARARIAARTGLHVVR
VEHLLNRYGSLAEEVLDLIAADPSLGEPLHAADDYLRAEVVYAASHEGARHLDDVLTRRT
RISIETFDRGTRSAREAAELMAPVLGWDEDQIAREVEHYEKRVEAERESQLQPDDHTADA
ARLGAPDIVPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgcgagctggacgtgctggtggtcggcggcggagtggtgggcgccggtacc
gcgctggacgccgtcacgcgtggcctgtccaccggcctggtagaggcccgtgactgggcg
tccggcacctccagccgctccagcaagctgatacacggcggcctgcgctatctggagatg
ctcgacttcgccctggtccgcgaggccctcaaggagcgcggactgctgctggagcgcctc
gccccgcacctggtcaagccggtcccgttcctctacccgctccagcacaagggctgggag
cggctgtacgcgggctcgggcgtcgcgctgtacgacgcgatgtccatggcccgcggccac
ggccggggcctgcccgtgcaccgccacctcacccgccgccacgccctgcgggtggccccc
tgcctgaagaaggacgccctggtcggcgccctccagtactacgacgcccagatggacgac
gcccgcttcgtcgccaccctggtgcgcacggccgcgtcctacggcgcgaaggtggccaac
cgcgcgcgcgtgaccgggttcctgcgcgagggggagcgggtcgtcggcgcccgggtgcag
gacgtggaggccggcggggagtacgagatccacgcccagcaggtcgtcaacgccaccggt
gtgtggaccgacgacacgcaggccatggtcggcgagcgcggccggttccacgtccgcgcc
tccaagggcatccacctggtcgtgcccaaggaccgcgtccactccaccaccggcctgatc
ctgcgcaccgagaagtccgtcctcttcgtcatcccctggggccggcactggatcatcggc
accaccgacaccgactgggacctggacaaggcccacccggccgcgtccagcgccgacatc
gactatctgctggagcacgtcaactcggtgctggccgtgccgctcagccgcgacgacgta
cagggggtgtacgcgggactgcgcccgctgctggccggcgagtccgacgccaccagcaag
ctgtcccgcgagcacacggtcgcccacccggtgccgggactggtggtcgtggccggcggc
aagtacacgacgtaccgggtgatggccaaggacgccgtcgacgaggccgtgcacgggctc
gacatgcgcgtggccgactgtgtcacggaggagaccccgctgctcggcgcggagggctac
caggcgctgtggaacgcgcgggcgcggatcgccgcgcgcaccggactgcacgtggtccgc
gtggagcacctgctgaaccggtacggctcgctggccgaggaggtcctggacctcatcgcc
gccgacccctcgctcggcgagccgctgcacgccgccgacgactacctgcgcgccgaggtg
gtgtacgccgcctcgcacgagggcgcccggcacctggacgacgtcctcacgcgtcgcacc
cgcatctccatcgagaccttcgaccgcggcacccgcagcgcccgcgaggcggccgagctg
atggcacccgtcctcggctgggacgaggaccagatcgcccgcgaggtcgagcactacgag
aagcgggtggaggccgagcgggagtcccagctccagccggacgaccacacggcggacgcc
gcgaggctgggcgcgccggacatcgtgccgctgtag

DBGET integrated database retrieval system