KEGG   Shewanella putrefaciens 200: Sput200_0892Help
Entry
Sput200_0892      CDS       T02015                                 

Definition
(GenBank) alkyl hydroperoxide reductase, flavoprotein component, AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shp  Shewanella putrefaciens 200
Brite
KEGG Orthology (KO) [BR:shp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sput200_0892
Enzymes [BR:shp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sput200_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored NAD_binding_7 Glutaredoxin DAO Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADV53368
UniProt: E6XLS2
LinkDB All DBs
Position
complement(991105..992676)
Genome map
AA seq 523 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLANDIVSLSSLVSLKEIQGERT
PAMTVINPELKTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQEEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLTTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVELTPRGEIIVDERGQTSVPGIFAA
GDVTNSPFKQIIIAMGSGATASLGAFDYLIRHSDEETAATKAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttgaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtctgcagatgagagcaaaaagtctcaagaattaaaaagtttagct
aatgacattgtcagcctatcttctctggtgagcctgaaagaaattcagggggaacgcacc
ccggcgatgacagtgataaacccagagcttaaaacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacctcactcgtactggccttactgcacacgggtggacacccaatc
aaactgagcgatgatatcatcgagcagatccgcaatctgccgggcaaatatgcctttgaa
acttatgtatcactgacctgccaaaactgcccagacgtagttcaggcactgaatatgatg
gcggccattaacccgaatatcaccaacgtgatgattgatggtgccctattccaagaagaa
gtagcgagccgtaatattatggccgtaccttctgtctacttaaatggcgaagtgtttgcc
gcaggtcgcatcagcataggtgagattttaaataaactggacaccaatgctgccagccgc
aaggccgatgaaattaatgaaaaagcccccttcgaagtcttagtcgttggcggcggccca
gcaggcgcagcagcagccatttatgctgcacgtaaaggacttcgcactggtattgttgcc
gacaagtttggcggccaagtcgctgaaaccgtgggtatcgagaactttatctcggtcaaa
gcgaccgaaggtccaaagctagtagccaaccttgaagcccatgtgcgtgactatgaagtc
gatatcatggataaccaaaaagccgtgtcattgacgactgacggtttgttcgaacttgaa
ctggcaagcggcgctaaattacgtagccgtaccgtattgctggcaacaggcgctcgctgg
cgcgaaatgaacgtccctggcgagaaagaataccgcggcaaaggcgttgcatactgccca
cattgtgatggcccgttatttaagggcaagcgtgtggctgtgatcggcggcggtaactca
ggtatcgaagcggctatcgaccttgcgaacatagtagaacatgtgactgtgctggaattt
gataaaaccctgcgcgccgacgatgtgctgcaacgtaaagccgcttctatgggtaacatt
aaaatcattacccaagcgatgaccactgaagtgacgggcgatggcactcgggtgaatggc
ctaaactacaccgaccgcgcaacgggtgaaagccaccatatcgcgctggcagggatcttc
gtacagattgggctagtacccaatgcggaatggttaaaaggcacagtggaattaacccca
aggggcgaaatcatcgtcgatgaacgcggccaaacctcagtcccaggtatttttgccgca
ggtgatgtcactaactcacctttcaagcaaattatcattgccatgggcagcggcgcgacc
gcatcactgggcgcatttgattacttaattcgccacagcgatgaagagaccgccgcgacc
aaagcagcttaa

DBGET integrated database retrieval system