KEGG   Shewanella putrefaciens 200: Sput200_2193Help
Entry
Sput200_2193      CDS       T02015                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00473  D-Alanine metabolism
shp00550  Peptidoglycan biosynthesis
shp01100  Metabolic pathways
shp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sput200_2193
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sput200_2193
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Sput200_2193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shp01011]
    Sput200_2193
Enzymes [BR:shp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sput200_2193
Peptidoglycan biosynthesis and degradation proteins [BR:shp01011]
 Precursor biosynthesis
  Amino acid ligase
   Sput200_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp Birna_VP2
Motif
Other DBs
NCBI-ProteinID: ADV54644
UniProt: E6XN54
LinkDB All DBs
Position
2502547..2503560
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFESSLAKSDQFSVLRVELDKLGQYRTAAGDDCEL
TNNREIRFRDETKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLHQYDDEAISQAQTALADWGSIFIKAASQGSSVGCYKVDDS
SKVAQVLKDAFGYAPYVVVEKTIKARELEVAVYEYNGEIVATLPGEIICDTNTFYTFDEK
YAKSSKARTDVVAKDVSVELSEQIRAYAIKAFKGMKLRHLSRIDFFLTAENEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINSQLSAKD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattaacttacttttgctgtgcggcggcggaagtgctgaacacgatatttca
ctgatgtcggctaactattttgaatcctcattggcaaaatccgatcaattttccgtatta
cgggtagaacttgataaattgggtcaatatcgcaccgcggcaggcgatgattgtgaactg
acgaataatcgcgaaatccgttttcgcgatgaaactaaagcgccttggcctgtggactat
gttattccttgcatccatggttatcccggcgaaacaggtgatatccagtcctatttcaac
cttatccaactgccctacttcggctgtgaatccgaagccagtagtaattgttttaataaa
atcaccgccaaaatgtggttttcagccctagggatccccaatactccctacatttttcta
caccaatatgatgatgaggcgatcagccaagcacaaaccgccttggctgattggggttca
atctttattaaagccgcgtcgcaaggatcgtctgtcggttgctataaagtggatgacagc
agcaaagtggcacaagtactcaaagatgccttcggctacgcaccctatgttgtcgtggaa
aaaaccattaaagcccgtgaattagaagtcgcggtatacgaatacaatggtgagattgtg
gcaaccctgccaggtgaaattatctgtgataccaataccttctacacctttgatgaaaaa
tacgccaaaagcagtaaggcacgcaccgatgtggttgcaaaagatgtttctgtagaactc
agtgaacagatccgtgcttatgctatcaaggcatttaaggggatgaagctgcgtcacctg
tcacgtatcgactttttcttaaccgctgaaaatgaaattttgctcaatgaaatcaacaca
ttcccaggttcgacaccgatttcaatgttccctaaaatgttgcaaaaccacggccacgac
tttaccgaatatttaagcctagtgatcaacagccagttatcggcaaaggattaa

DBGET integrated database retrieval system