KEGG   Sarcophilus harrisii (Tasmanian devil): 100913352
Entry
100913352         CDS       T02286                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04060  Cytokine-cytokine receptor interaction
shr04068  FoxO signaling pathway
shr04144  Endocytosis
shr04218  Cellular senescence
shr04350  TGF-beta signaling pathway
shr04380  Osteoclast differentiation
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04659  Th17 cell differentiation
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05142  Chagas disease
shr05161  Hepatitis B
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100913352 (TGFBR2)
   04350 TGF-beta signaling pathway
    100913352 (TGFBR2)
   04390 Hippo signaling pathway
    100913352 (TGFBR2)
   04068 FoxO signaling pathway
    100913352 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100913352 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100913352 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100913352 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100913352 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100913352 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100913352 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100913352 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913352 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100913352 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100913352 (TGFBR2)
   05212 Pancreatic cancer
    100913352 (TGFBR2)
   05225 Hepatocellular carcinoma
    100913352 (TGFBR2)
   05226 Gastric cancer
    100913352 (TGFBR2)
   05220 Chronic myeloid leukemia
    100913352 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100913352 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100913352 (TGFBR2)
   05161 Hepatitis B
    100913352 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100913352 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100913352 (TGFBR2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100913352 (TGFBR2)
Protein kinases [BR:shr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100913352 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH Pkinase_fungal
Other DBs
NCBI-GeneID: 100913352
NCBI-ProteinID: XP_031796276
LinkDB
Position
5
AA seq 566 aa
MSRALPRSPGLLLLFLWTRIASTIPPHVQKMVDGNPVTEENGALKTALLCKFCDVQATNC
TSNDRNCLSFCDITSICEQAHEICVAVWRKNDKNVTIETLCHDPSLKVHGFALEDTNSDK
CLMKEKKVPGETFFMCSCRKEECNDILFFSEEVFDHSELLAIISKVTIISLLPPVGIAIA
VIVIFYCYRVHRRRKLSTTWESSKSRKLVECSDRCAMMMDDDRSDISSTCANNLNHNTEL
LPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKEIFSDINLKH
ENILQFLTAEERKMDLGKQYWLITAFHARGNLQEYLTRHVISWEDLWKLGSSLSRGIAHL
HSDHTPCGRPKTAIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGT
ARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNEIGEVKEYEPPFGSKVREH
PCVESMKDNVLRDRGRPEIPNTWLSHRGIQMVCETLAECWDHDPEARLTAQCVAERFEEL
SDLDRLSGRSCSEEKIPEDCSLSTPK
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgagtcgggctctcccgcggagcccggggctgctgctcctcttcctgtggacgcgcatc
gccagcaccatccctccccacgtccagaagatggttgatggaaatccggtcactgaggaa
aatggtgcattaaagaccgcgctcctctgcaagttctgtgatgtacaagcaaccaactgc
accagcaatgacaggaactgcttaagtttctgcgacatcacttcgatctgtgaacaagcc
catgaaatctgcgtggctgtgtggaggaagaatgataaaaatgtaaccatagaaactctc
tgccatgatcctagcctcaaagtccatggctttgctctggaggatactaattctgacaaa
tgcttgatgaaggaaaagaaggtccctggtgagaccttcttcatgtgttcctgcaggaag
gaggaatgcaatgatatcttattcttctcagaagaagtttttgaccactccgagcttttg
gccatcatctccaaagtgaccatcatcagcctccttccgcccgtgggcatcgctatcgcc
gtgattgtcatcttctactgctaccgggtacaccgcaggagaaagctgagtaccacctgg
gagagcagcaagtcgcggaagctggtagagtgcagcgaccgctgtgccatgatgatggat
gacgaccgctcggacataagctccacctgcgccaacaacctcaatcacaacacagagctg
ctgcccatcgagctggacaccctggtgggcaaggggcgctttgctgaggtctacaaggcc
aagctgaaacagaacacttccgagcagttcgagacggtggcggtcaagatctttccctat
gaggaatatgcctcctggaagactgaaaaggagatcttctcggacatcaacctcaagcat
gagaacatccttcagttcctgacggcggaggagcggaagatggacttgggaaagcagtat
tggctcatcaccgccttccatgccaggggcaacctgcaggagtacctcaccaggcacgtc
atcagctgggaggacctgtggaagctgggcagctccctgtccaggggcatcgcccatctc
catagcgaccacactccctgcgggagaccaaaaacagccatcgttcacagagacctgaag
agctccaacatcctagtgaaaaacgacctgacctgctgcctctgtgactttgggctgtcc
ctgagattggacccgaccctctctgtggatgacttggccaacagcgggcaggttgggaca
gcaagatatatggctcctgaggttttggaatccagaatgaacttggaaaatatggagtcc
ttcaagcaaacagatgtatattccatggccctggttctctgggaaatgacgtctcgctgc
aatgagataggagaggtcaaggaatatgagccgccatttggttccaaagtgagagagcat
ccctgcgtcgagagcatgaaggacaacgtgctgagagaccggggtcggcctgagatcccc
aacacgtggctcagccaccgaggtatacagatggtttgtgagactttggccgagtgctgg
gaccacgatccagaagcacggctgaccgcccagtgcgtggccgaacgttttgaagaactg
agcgatctggatcggctgtcggggagaagctgttcagaggagaagatccctgaggactgc
tccctgagcacccccaagtaa

DBGET integrated database retrieval system