KEGG   Sarcophilus harrisii (Tasmanian devil): 100913844
Entry
100913844         CDS       T02286                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04060  Cytokine-cytokine receptor interaction
shr04068  FoxO signaling pathway
shr04144  Endocytosis
shr04218  Cellular senescence
shr04350  TGF-beta signaling pathway
shr04371  Apelin signaling pathway
shr04380  Osteoclast differentiation
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04659  Th17 cell differentiation
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05142  Chagas disease
shr05161  Hepatitis B
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100913844 (TGFBR1)
   04350 TGF-beta signaling pathway
    100913844 (TGFBR1)
   04390 Hippo signaling pathway
    100913844 (TGFBR1)
   04371 Apelin signaling pathway
    100913844 (TGFBR1)
   04068 FoxO signaling pathway
    100913844 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100913844 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100913844 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    100913844 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100913844 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100913844 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100913844 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100913844 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913844 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100913844 (TGFBR1)
   05212 Pancreatic cancer
    100913844 (TGFBR1)
   05225 Hepatocellular carcinoma
    100913844 (TGFBR1)
   05226 Gastric cancer
    100913844 (TGFBR1)
   05220 Chronic myeloid leukemia
    100913844 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100913844 (TGFBR1)
   05161 Hepatitis B
    100913844 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100913844 (TGFBR1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100913844 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100913844 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100913844 (TGFBR1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100913844 (TGFBR1)
Protein kinases [BR:shr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100913844 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 100913844
NCBI-ProteinID: XP_031801391
Ensembl: ENSSHAG00000016699
LinkDB
Position
1
AA seq 563 aa
MGGPPPSSYKGAERGRGARRGSRVPRGGGSETRPRPLERTGRGGRRGTMEAAAAAAAVAG
KATVPPRYQMFLLLAATGLVPGAAGLQCYCHLCIKENYTCVTDGICFVAVTQNADKVIYN
SMCIPEVDLIPRDRPFVCAPSLRDGFLMSPFCCSKDHCNKIEFPTVSLPSLLGTPMKPSN
LGPVELAAVIAGPVCLVCISLMLMIYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVDEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgggagggccacccccgagcagttacaaaggggccgaacgaggccgcggcgcgaggcga
ggctctcgggttcctcggggcgggggctccgagacgcggccccggcccctggaacggacc
ggacgcggaggacgtcgcgggaccatggaggcggccgcggcggctgcggccgtcgcgggg
aaggcgactgttcccccccgctaccagatgtttctcctcctggcggccacggggctggtc
ccaggggcggcgggtttgcagtgttactgccacctctgcattaaagaaaactacacatgt
gtgacagatggaatttgctttgttgctgtaacacagaatgcagacaaagttatatacaat
agcatgtgtataccagaagttgatttaattccccgagataggccatttgtatgtgctcct
tctttaagagatgggtttttgatgtcacctttctgttgttccaaagaccactgcaataaa
atagaattcccaacagtttctttaccctctcttttaggtacccctatgaaaccatctaat
cttggtcctgtggaattggcagctgttattgctggacctgtttgccttgtctgtatctca
ttgatgttaatgatctacatttgccacaatcgtactgtcatacatcatcgtgttccaaat
gaagaagatccctcattagatcgcccttttatttcagagggtacaacattaaaggaccta
atttatgacatgacaacatcaggatctgggtcaggattaccattacttgttcaaagaact
attgcaagaactattgtattgcaagaaagcatagggaaaggtcgatttggagaagtctgg
agaggaaaatggagaggagaagaagtggcagtaaaaatattttcttcaagagaagaacgt
tcatggttccgtgaagcagaaatttatcaaactgtaatgttacgccatgaaaacattctg
ggatttatagcagctgacaataaagacaatggtacatggactcagctttggttggtttca
gattatcatgagcatgggtccctttttgattatttaaatagatacacagtcactgtggaa
ggaatgataaaattagctttatccactgctagtggacttgcacatcttcacatggagatt
gttggcactcaaggcaaaccagcaattgcccatagagatctgaaatcaaagaatatttta
gtcaagaagaatggaacgtgctgtattgcagacttaggacttgcagtaagacatgattca
gccacagatacaattgatatagctccaaaccacagagtgggaacaaaaagatacatggct
cctgaagttcttgatgattccataaatatgaagcattttgaatcattcaagcgtgctgac
atctatgcaatgggattagttttctgggaaatagctcggagatgttcaattggtggaata
catgaagactaccaactgccttattatgatctcgtaccttctgacccatcagtagatgaa
atgcggaaagttgtttgtgaacagaagttacgaccaaatattccaaatcggtggcagagc
tgtgaagccttgagagttatggccaaaattatgcgagaatgttggtatgccaatggagca
gctaggcttacagctttacgtattaagaaaacattatcacaactcagtcaacaggagggc
ataaaaatgtaa

DBGET integrated database retrieval system