KEGG   Sarcophilus harrisii (Tasmanian devil): 100914017
Entry
100914017         CDS       T02286                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04072  Phospholipase D signaling pathway
shr04144  Endocytosis
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04520  Adherens junction
shr04540  Gap junction
shr04630  JAK-STAT signaling pathway
shr04810  Regulation of actin cytoskeleton
shr04912  GnRH signaling pathway
shr04915  Estrogen signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100914017 (EGFR)
   04012 ErbB signaling pathway
    100914017 (EGFR)
   04014 Ras signaling pathway
    100914017 (EGFR)
   04015 Rap1 signaling pathway
    100914017 (EGFR)
   04630 JAK-STAT signaling pathway
    100914017 (EGFR)
   04066 HIF-1 signaling pathway
    100914017 (EGFR)
   04068 FoxO signaling pathway
    100914017 (EGFR)
   04020 Calcium signaling pathway
    100914017 (EGFR)
   04072 Phospholipase D signaling pathway
    100914017 (EGFR)
   04151 PI3K-Akt signaling pathway
    100914017 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100914017 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100914017 (EGFR)
   04520 Adherens junction
    100914017 (EGFR)
   04540 Gap junction
    100914017 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100914017 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100914017 (EGFR)
   04915 Estrogen signaling pathway
    100914017 (EGFR)
   04921 Oxytocin signaling pathway
    100914017 (EGFR)
   04926 Relaxin signaling pathway
    100914017 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100914017 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914017 (EGFR)
   05206 MicroRNAs in cancer
    100914017 (EGFR)
   05205 Proteoglycans in cancer
    100914017 (EGFR)
   05230 Central carbon metabolism in cancer
    100914017 (EGFR)
   05231 Choline metabolism in cancer
    100914017 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100914017 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100914017 (EGFR)
   05212 Pancreatic cancer
    100914017 (EGFR)
   05225 Hepatocellular carcinoma
    100914017 (EGFR)
   05226 Gastric cancer
    100914017 (EGFR)
   05214 Glioma
    100914017 (EGFR)
   05218 Melanoma
    100914017 (EGFR)
   05219 Bladder cancer
    100914017 (EGFR)
   05215 Prostate cancer
    100914017 (EGFR)
   05213 Endometrial cancer
    100914017 (EGFR)
   05224 Breast cancer
    100914017 (EGFR)
   05223 Non-small cell lung cancer
    100914017 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100914017 (EGFR)
   05171 Coronavirus disease - COVID-19
    100914017 (EGFR)
   05163 Human cytomegalovirus infection
    100914017 (EGFR)
   05165 Human papillomavirus infection
    100914017 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100914017 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100914017 (EGFR)
   01522 Endocrine resistance
    100914017 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100914017 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100914017 (EGFR)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100914017 (EGFR)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100914017 (EGFR)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100914017 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100914017 (EGFR)
  Exosomal proteins of bladder cancer cells
   100914017 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like VPS13_mid_rpt
Other DBs
NCBI-GeneID: 100914017
NCBI-ProteinID: XP_031812944
Ensembl: ENSSHAG00000008346
LinkDB
Position
1
AA seq 1213 aa
MGLYGAAGAAVLVLLAGHFSLNSALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQKGYDLSFLKTIQEVSGYVLIALNTVEKIPLENLQIIRGNVLYENFYALS
VLSNYDVNKTGVRELPMRSLLEILVGGVRFNNNPALCNVHTIQWKDIVDSSFFNNISIDN
NNPPKNCEKCNSSCPNGSCWGPGPHNCQTLTKTICAQQCSGRCRGSSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPDGKYSFGATCVRKCPHNYV
VTDHGSCVRSCNAETYEVEEDGVRKCKKCEGPCSKVCNGIGIGEFKDVLSINATNIKQFE
NCTTISGDLLILPVAFKGDSFTHTPPLDPKELNILRTVKEISGFLLIQAWPENMTDLHAF
EHLEIIRGRTKQHGQFSLAIVGLDITSLGLRSLKEISDGDVVISRNRQLCYANTINWTKL
FGTKSQKTKITNNKDEKECQALEHVCHSLCSSDGCWGPKPSHCLSCRHVSRNKKCVAKCN
IFEGEPREYMEDLKCMQCHPECLPQVQNQTCTGPGPDKCIECAHFIDGPHCVKTCPAGIM
GENDTLVWKYADANKVCQRCHPNCTYGCEGPGLEGCPTSGPRIPSIAIGIVGGFLLLMVL
SLGIGLFIRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYIREHKDNIGSQYLLNWCVQIAKGMSYLEERRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIVEFSKMARDPQRYLVIQGDERMHLPSPTDSKFYRTLMEEEDMEDIVDADEYLIPQ
QGFFNSPSTSRTPLLSSLSATSNNSATVCIDRNGQTCPVKEESFIQRYSSDPTTVLFEDN
VDDSFQPVPEYINQSAPKNRMGSAIQNPVYHNQPLNPDASKDSLYQNSHNSSAVDNPEYL
NTTQPNLVKKTFDSNSCWNPTANHPISLDNPDYQQDFFPQEAKPNGVYKVPAAENPEYLR
VAAQQSEFIQASA
NT seq 3642 nt   +upstreamnt  +downstreamnt
atggggctctacggggctgctggagccgctgtcctggtgctgcttgccggacatttctcc
ctgaactcggcgctggaggaaaagaaagtttgccaaggaacaagtaataagctgacccag
ttgggtacttttgaagaccacttcttgagtctccaaaggatgtttaataattgtgaggta
gtacttggaaatttggaaattacctatgtccagaaaggttatgacctttccttcctaaaa
accatccaggaggtttctggctatgtgcttattgctctcaatacagtagagaagattcct
ttggaaaatttgcagatcatcagaggaaatgtgttatatgaaaacttttatgcactttct
gtgctctccaattatgatgtgaataaaacaggagtgagggaattgcccatgaggagtctc
ctcgaaattcttgttggtggtgttcggttcaacaataacccagctctgtgtaatgtgcat
acaatccagtggaaggatattgtggactccagctttttcaacaatatctcaatagacaat
aacaatcctcctaagaattgtgaaaagtgtaattctagttgtcccaatggaagctgttgg
ggtcctggaccacacaattgccagactttgacaaaaaccatctgtgcacagcagtgctca
ggacgctgtcgaggtagttcccccagtgactgttgccataaccagtgtgcagcaggatgt
actggaccccgagagagtgactgtttggtctgccgaaaatttcgagatgaagccacatgc
aaagatacctgccctcctctgatgctgtataaccccaccacatatcagatggatgtcaat
ccagatggcaaatacagctttggagccacctgtgtacgcaagtgtccacataactatgtg
gtgacagaccatggttcttgtgttcgctcctgtaatgctgagacttatgaagtggaagaa
gatggtgtccgaaaatgtaaaaagtgtgaaggtccatgtagtaaagtttgcaacggaata
ggaattggtgaatttaaagatgttctctccatcaatgcgacaaacatcaaacaatttgag
aattgtaccacaatcagcggcgatctgcttatcttgcctgttgcgtttaaaggtgattcc
ttcacacatactccacctctagatcccaaagaactgaatattctcaggactgtgaaggaa
atatcaggatttttgctgattcaggcttggcctgaaaacatgactgaccttcatgctttt
gaacatctggaaattatacggggccgaacaaagcaacatggtcaattttctcttgctatt
gttggtttggacataacttccttgggcttacgttcccttaaggaaatcagtgatggcgat
gtcgtcatttcaagaaacagacaactctgctatgcaaacacaataaactggactaaactg
tttggaacaaaaagtcagaaaaccaaaatcaccaacaacaaagatgaaaaagagtgtcag
gctctggagcatgtttgtcattcattgtgctcatctgatggttgctggggtccaaaacca
agccactgcttgtcctgtcgccatgtaagccgtaacaagaaatgtgtcgcaaaatgcaac
atttttgaaggagaaccaagagaatacatggaagatctgaaatgtatgcaatgccaccct
gagtgtctgcctcaggtccagaatcaaacctgcacaggaccgggtcctgacaaatgtata
gagtgtgctcactttatagatggtccacactgtgttaagacttgtccagctggaatcatg
ggagaaaatgataccttggtctggaaatatgctgatgcaaataaggtttgccaacgatgc
catcccaattgtacctatgggtgtgaaggtccaggtcttgaaggatgtcccacatctggc
cccaggattccttccattgctattggaattgtcggtggctttcttttattaatggttttg
agccttggtattggtctcttcattcgaaggcgccatattgtccgtaaacgtacactacgc
aggctgctacaagaaagagagctagttgagcctctcacccccagtggagaagctcccaat
caggctcttttacggatcctcaaggagacagaatttaaaaagatcaaagtccttggctct
ggagcttttggcacagtgtataagggactgtggattccagaaggagagaaggtgaaaatt
cctgtcgccattaaagagttaagagaggctacttctccgaaagccaataaggaaattctt
gatgaagcctatgtaatggccagtgtggacaatccccatgtgtgtcgtctcctgggaatc
tgtctgacctctacagtccaactcataacacagctcatgccattcggctgcctcctggac
tacatacgggaacacaaggacaacattggctcccagtatcttctcaactggtgtgtgcag
atagccaagggtatgagttacctagaagagcgccgcttggtacaccgtgacttagcagcc
agaaatgtccttgtgaagacacctcaacacgtcaaaattacagattttgggctggcaaaa
ttgcttggtgctgaagaaaaagaatatcatgcagaaggaggcaaggtgcctattaagtgg
atggctttggaatcgattttacaccgaatttatacccaccaaagtgatgtctggagctat
ggtgtcacagtttgggagctaatgacatttggatccaaaccttatgatggaattcctgca
agtgaaatttcatctatattagaaaagggggaacgccttccccagccacctatctgcact
attgatgtgtacatgatcatggtcaaatgctggatgatagatgctgatagtcgccctaaa
tttcgtgagttaattgtagaattctctaaaatggcccgagatcctcagcgctaccttgtt
atacagggagatgaaagaatgcacttgccaagccccacagactccaaattttatcgcacc
ctgatggaagaggaggacatggaagatatcgtagatgcagatgagtacctcattccgcag
caaggtttcttcaacagcccctccacatcccgcacgcctcttctaagctctctgagtgct
accagcaataattctgccacagtttgcattgatagaaatgggcagacttgtcctgtgaag
gaagaaagcttcattcagcgatacagttctgatcccaccactgtcttatttgaagacaat
gtggatgatagcttccagcctgtacccgaatatataaaccagtcggctcccaaaaaccgc
atgggttctgccatccagaaccctgtctatcacaaccagcctttaaacccagatgcctct
aaagactctctgtaccaaaactcacacaacagcagtgcagtggacaaccctgagtatctc
aacacaacccagcctaacttagtcaaaaagaccttcgacagcaattcttgctggaaccca
acagccaaccacccaatcagtctggacaaccctgactaccagcaggacttcttcccccag
gaagccaagccaaatggggtttataaagttcctgctgcggaaaatcctgagtatctcaga
gtagcagcacaacaaagtgaattcattcaagcttcagcatga

DBGET integrated database retrieval system