KEGG   Sarcophilus harrisii (Tasmanian devil): 100915696
Entry
100915696         CDS       T02286                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr05144  Malaria
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05211  Renal cell carcinoma
shr05218  Melanoma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100915696 (HGF)
   04014 Ras signaling pathway
    100915696 (HGF)
   04015 Rap1 signaling pathway
    100915696 (HGF)
   04020 Calcium signaling pathway
    100915696 (HGF)
   04151 PI3K-Akt signaling pathway
    100915696 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100915696 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100915696 (HGF)
   05205 Proteoglycans in cancer
    100915696 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100915696 (HGF)
   05226 Gastric cancer
    100915696 (HGF)
   05218 Melanoma
    100915696 (HGF)
   05211 Renal cell carcinoma
    100915696 (HGF)
   05223 Non-small cell lung cancer
    100915696 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    100915696 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100915696 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100915696 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100915696 (HGF)
Cytokines and growth factors [BR:shr04052]
 Growth factors
  Growth factors (RTK binding)
   100915696 (HGF)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100915696 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986
Other DBs
NCBI-GeneID: 100915696
NCBI-ProteinID: XP_003771507
Ensembl: ENSSHAG00000015775
LinkDB
Position
5
AA seq 729 aa
MWVTQLLPILVLHQVLQHLLLLPITISFAEGQRKRNTLHEFKKSAKTTLIRIDSSLNIKT
KKLNTTDKCAKRCIRNKGLPFTCKAFAFDKAKKRCHWFPFNSMSNGVRKKHDHEFDLYEN
KDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHGFLPSSYRGKDLQENYCRNPR
GEEGGPWCFTSNPEVRHEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTPH
RHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSTMNNSDIPME
TTHCVRGQGEGYRGTVNTIWNGIPCQRWDTQYPHQHDITPENFKCKDLRENYCRNPDGAE
SPWCFTTDPNIRIGYCSQIPKCDVSNQQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMED
LHRHTFWEPDASKLNKNYCRNPDDDAHGPWCYTGNLLVPWDYCPISRCEGDTTPTIVNLD
HPVISCAKTKQLRVVNGIPTQTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSGTK
DLKDYEAWLGIHDVHGRGEEKHKQVLNISQLVYGPEGSDLVLLKLARPAVLDDFVSTIDL
PNYGCTIPEKTTCSVYGWGYTGLINFDGLLRVAHLFIMGNEKCSQYHQGKITLNESEICA
GTEKIGTGPCEGDYGGPLVCEQHKMRMVIGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKI
MLTYKVSQS
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtgggtgacccaacttctgccaatattggtgttgcatcaggttcttcaacatctcctt
cttcttcccatcaccatttcctttgcagagggccagaggaaaagaaacaccctacatgaa
ttcaaaaagtcagcaaagactactcttatcagaatagactcatcactgaatattaaaacc
aaaaagctgaacacgacggacaaatgtgccaagagatgtattaggaataaaggtcttcca
ttcacttgcaaggcttttgcttttgacaaagcaaaaaaacgatgtcattggttccctttc
aatagcatgtcaaatggagtgagaaagaagcatgaccatgaatttgatctgtatgaaaac
aaagactacattagaaactgtatcattggtaaagggggaagctacaagggaactgtatct
ataactaagagtggtatcaaatgtcagccatggaattcgatgataccacatgaacacggc
tttttgccttcgagctatcgggggaaagacctacaggaaaattactgtcgaaaccctcga
ggggaagaaggaggaccatggtgtttcacaagcaatccagaggtacgccatgaagtctgt
gacattcctcagtgttcagaagttgagtgtatgacttgcaatggggaaagttaccgaggt
cccatggatcatactgaatcaggcaagatatgtcagcgctgggatcaccagacaccacac
cgacacaaattcttaccagagagatatcctgacaagggctttgatgataattattgccgc
aatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccttgggag
tactgtgcaattaaaacatgtgctcatagtactatgaataatagtgatattcctatggaa
acaacccattgtgtcagaggtcaaggagaaggttatcgaggtactgtcaacacaatatgg
aatggaattccatgccagcgctgggacacccagtatcctcatcaacatgatataactcct
gagaactttaagtgcaaagacctaagagaaaattactgtcgaaatccagatggggctgaa
tcaccctggtgttttacaacagatccaaacattcgaattggctattgttcccagattcca
aagtgtgatgtttcaaatcaacaagactgttatcgtggaaatggcaagaattatatggga
aatttgtccaaaacaagatctgggctaacttgttccatgtgggacaagaatatggaagac
ttacaccgacatactttttgggaaccagatgctagtaaactgaataagaattactgccgt
aatcctgatgatgatgctcatgggccatggtgttacacaggcaatttgctagttccttgg
gattactgcccaatctctcgctgtgaaggtgatactacacccacaatagtcaatttagac
catcctgtcatttcctgtgcaaaaacaaaacaattacgagtagtaaatggaatcccaaca
caaacaaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtggaggt
tcattaattaaagaaagttggattttaactgcaagacaatgtttcccttctggaactaaa
gatttgaaagactatgaagcttggcttgggattcatgatgtccatggaagaggagaagag
aaacacaaacaagttttaaatatctctcaattagtatatggacctgaaggatcagatctg
gttttactaaagcttgcaagacctgcagtactagatgactttgttagtacaattgattta
cctaattatggctgcacaattcctgaaaagactacatgtagtgtatatggatggggatac
actggattaatcaattttgatggccttcttcgtgtggcacacttgtttatcatgggaaat
gagaagtgtagtcaatatcaccaaggaaagatcactctgaatgaatctgaaatctgtgct
ggaactgaaaaaataggaacaggaccatgcgagggagattatggtggcccattggtttgt
gaacaacataaaatgagaatggtcattggtgttattgtacctggtcgtggctgtgccatt
ccaaaccgccctgggatttttgttcgagtagcttattatgcaaaatggattcacaaaatc
atgttgacatacaaggtatctcagtcatag

DBGET integrated database retrieval system