KEGG   Sarcophilus harrisii (Tasmanian devil): 100916232
Entry
100916232         CDS       T02286                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03420  Nucleotide excision repair
shr04115  p53 signaling pathway
shr04120  Ubiquitin mediated proteolysis
shr05161  Hepatitis B
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100916232 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100916232 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100916232 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916232 (DDB2)
   05202 Transcriptional misregulation in cancer
    100916232 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100916232 (DDB2)
   05212 Pancreatic cancer
    100916232 (DDB2)
   05225 Hepatocellular carcinoma
    100916232 (DDB2)
   05226 Gastric cancer
    100916232 (DDB2)
   05214 Glioma
    100916232 (DDB2)
   05216 Thyroid cancer
    100916232 (DDB2)
   05220 Chronic myeloid leukemia
    100916232 (DDB2)
   05217 Basal cell carcinoma
    100916232 (DDB2)
   05218 Melanoma
    100916232 (DDB2)
   05213 Endometrial cancer
    100916232 (DDB2)
   05224 Breast cancer
    100916232 (DDB2)
   05222 Small cell lung cancer
    100916232 (DDB2)
   05223 Non-small cell lung cancer
    100916232 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100916232 (DDB2)
   05169 Epstein-Barr virus infection
    100916232 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100916232 (DDB2)
   03400 DNA repair and recombination proteins [BR:shr03400]
    100916232 (DDB2)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100916232 (DDB2)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100916232 (DDB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 100916232
NCBI-ProteinID: XP_031799818
Ensembl: ENSSHAG00000017108
LinkDB
Position
6
AA seq 454 aa
MAPKRPAGLGKRSAPAPEPPTAKRRCVRTTGRRGRPPARGSGKGDGAGVGWKQRALIGQR
ESPYSIIWALHQHILGAPQPSFHQCLQKVFLHSLGSYRLFRTASPFDRRTTCLEWHPTHP
STLAVGSKGGDIILWDYEVLDKTYFIKGIGAGGSITSMKFNPLNTNQLFISSVAGTTSLK
DFLGNTITVFTSTNTWDYWYTSVDVSVKSRVVATGDSMGNVILLNMDGKEIWNLRLHKKK
VTHVSLNPLCDWLLATASVDQTVKIWDLRQIRGKSSFLHWMPHERAVSAAYFSPDGTKLL
TTDQHSEIRVYSASHWACPQHLIAHPHRHFQHLTPIKATWHPRFDLIVVGRYPDPNFAGF
TPHEPRTIDVFDGNSGKMACQLYDPDCSGIISLNKFNPIGDTLASAMGYNILIWSPQEVV
RRKQEGLMKAMNEHGLGRGRSVHQPSPRNRPGQN
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggcccccaagcgtccggcgggcctcggcaagaggagcgcccccgccccggagcctccc
acggccaagaggcggtgtgtgcggaccacgggccgcagaggccggccgccagcccggggc
tctggcaaaggggatggtgctggggtaggctggaaacagcgtgcattgattggtcagagg
gaatccccttatagcatcatttgggctctgcaccaacatatcctgggagctcctcagcca
tcattccatcagtgtcttcagaaggtctttttgcactctctgggatcttaccgacttttc
cgcacagccagtccctttgatcggagaacaacctgcctggaatggcacccaactcacccc
agcactctggctgtgggctctaagggaggagacatcatcctttgggactatgaagtactg
gataaaacctacttcattaaagggattggagctggaggcagcatcacaagcatgaagttt
aaccctctcaataccaatcagctgttcatttcctcagtggcgggtaccaccagcctcaag
gacttcctgggcaacacaattacagtctttaccagcacaaacacctgggactactggtac
actagtgtggatgtgtctgtcaaaagtcgtgtggtggccactggagatagtatgggcaac
gtgatcttgctgaacatggacggcaaagagatctggaatctcaggctccacaaaaagaag
gtgacccatgtgtctttgaatcctctctgtgactggctgctggccacagcctcggtggac
cagacggtgaaaatctgggacctgcgccagatcagagggaagtcgtccttcctccactgg
atgcctcatgagcgtgctgtcagtgcagcttatttcagtccagacgggaccaaactcctg
accacagaccagcacagcgagatccgggtgtattctgcctcccactgggcatgcccccag
catctcattgctcacccgcatcgccacttccagcacctcacgcccatcaaggcaacgtgg
catccccgttttgacctcatcgtggtgggccgctatccagaccccaactttgcaggattc
acccctcatgagcctcggacaattgatgtatttgatggaaactcagggaagatggcgtgc
cagctttatgacccagactgctctggcatcatctcgctaaacaagtttaatcccatcggg
gacaccctggcctctgcgatgggttacaacattctcatctggagcccccaggaggttgtg
cgcaggaagcaggaggggctgatgaaggcaatgaatgagcacggtctggggaggggccgc
tcggttcaccagccctcccctcggaaccgaccgggccagaactag

DBGET integrated database retrieval system