KEGG   Sarcophilus harrisii (Tasmanian devil): 100917086Help
Entry
100917086         CDS       T02286                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
shr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100917086
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100917086
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100917086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Motif
Other DBs
NCBI-GeneID: 100917086
NCBI-ProteinID: XP_012404995
Ensembl: ENSSHAG00000012096
UniProt: G3WFE8
LinkDB All DBs
Position
4
AA seq 517 aa AA seqDB search
MRLLLLLSVLGVCWAQYNPHTVPGRTSIVHLFEWRWDDIALECERYLAPNGFGGVQISPP
NENVVINNPSRPWWERYQPVSYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVVNHMCGN
GVSSGTSSTCGSYFNPGLRDFPDVPYSAWDFNDGKCKSYSGDVENYNDIYQVRDCRLVGL
LDLALEKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDMKAFLDKLKNLNTSWFPEG
ARPFIYQEVIDLGGEAIKSSDYFGNGRVTEFKYGAKLGTVLRKWSGEKMAYLKNWGEGWA
FMPSNRALVFVDNHDNQRGHGAGGSSILTFWDPRLYKMGVGFMLAHPYGFTRVMSSFRWP
RYFVNGKDINDWVGPPNENGVIKRVTVNPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
FTNWWDNGNNQVAFGRGNRGFIVFNNDDWELSVTLQTGLPAGTYCDVISGDKIDNQCTGI
KIYVSGDGRAYFNIKNTAEDPFIAIHMDSKLHIKLDK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcttgctgttgctttcagtccttggggtctgctgggcacagtacaacccccat
accgtacctggtcgaacatctattgtccacttatttgaatggcgctgggatgacattgct
ctcgaatgtgagcgttacctagctcccaatggcttcgggggtgttcagatttcacctcca
aatgagaatgtagtgatcaataatccttcaagaccttggtgggaaagataccagccagtt
agctacaagatatgcacacggtctggaaatgaagatgaattcagagacatggtgacaaga
tgcaacaatgttggagtgcgcatttatgtggatgctgtagtgaatcatatgtgtgggaat
ggtgtgagttctggaacaagtagcacctgtggaagttacttcaatcctggattaagagac
tttcctgatgttccatattctgcctgggattttaatgatggcaaatgtaaaagctatagt
ggggacgttgaaaactacaatgatatttatcaggttagagattgtcgtttggttgggctt
ctcgatcttgccctggagaaagattatgtgcgttccaagattgctgagtatatgaaccac
ctgattgacattggtgtggcaggattcagaattgatgcttccaaacatatgtggcctgga
gacatgaaggcatttctggataagctgaagaacttaaacacaagctggttccctgaagga
gccagaccattcatttaccaggaggtaattgatctaggtggtgaggcaattaaaagcagt
gactactttggaaatggtcgggttacagaattcaaatatggtgcaaaactgggcacagtt
ctacgcaagtggagtggagaaaagatggcttatttaaagaattggggagaaggctgggcc
ttcatgccttcaaacagagcccttgtctttgtggataatcatgataatcagaggggtcat
ggagctggaggatcttccattctcactttctgggaccccagattgtacaaaatgggagtt
ggatttatgcttgctcatccttatggatttacacgagtgatgtcaagcttcaggtggcca
agatattttgtaaatggaaaggatattaatgattgggttggaccacccaatgaaaatgga
gtgattaaacgagtaactgtcaatccagatactacttgtggcaatgactgggtttgtgaa
caccgatggcgtcaaataaggaacatggttattttccgtaatgtagttgatggccagcct
tttacaaattggtgggacaatggaaataaccaggtagcttttggtagagggaatagagga
ttcatcgtatttaacaatgatgactgggaattgtcagtaactctacaaactggtcttcct
gctggaacctactgtgatgtcatttctggagataaaattgataaccaatgtacaggaatt
aaaatctatgtttctggtgatggtcgtgcttacttcaatattaagaacactgctgaagat
ccatttattgccatccacatggattctaaattacacatcaaactggataaatag

DBGET integrated database retrieval system