KEGG   Sarcophilus harrisii (Tasmanian devil): 100920192
Entry
100920192         CDS       T02286                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04012  ErbB signaling pathway
shr04062  Chemokine signaling pathway
shr04110  Cell cycle
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04310  Wnt signaling pathway
shr04340  Hedgehog signaling pathway
shr04360  Axon guidance
shr04390  Hippo signaling pathway
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04657  IL-17 signaling pathway
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04722  Neurotrophin signaling pathway
shr04728  Dopaminergic synapse
shr04910  Insulin signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05135  Yersinia infection
shr05160  Hepatitis C
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05217  Basal cell carcinoma
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100920192 (GSK3B)
   04310 Wnt signaling pathway
    100920192 (GSK3B)
   04340 Hedgehog signaling pathway
    100920192 (GSK3B)
   04390 Hippo signaling pathway
    100920192 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100920192 (GSK3B)
   04150 mTOR signaling pathway
    100920192 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100920192 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100920192 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100920192 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100920192 (GSK3B)
   04657 IL-17 signaling pathway
    100920192 (GSK3B)
   04662 B cell receptor signaling pathway
    100920192 (GSK3B)
   04062 Chemokine signaling pathway
    100920192 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100920192 (GSK3B)
   04917 Prolactin signaling pathway
    100920192 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100920192 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100920192 (GSK3B)
   04916 Melanogenesis
    100920192 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100920192 (GSK3B)
   04722 Neurotrophin signaling pathway
    100920192 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100920192 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100920192 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100920192 (GSK3B)
   05225 Hepatocellular carcinoma
    100920192 (GSK3B)
   05226 Gastric cancer
    100920192 (GSK3B)
   05217 Basal cell carcinoma
    100920192 (GSK3B)
   05215 Prostate cancer
    100920192 (GSK3B)
   05213 Endometrial cancer
    100920192 (GSK3B)
   05224 Breast cancer
    100920192 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100920192 (GSK3B)
   05162 Measles
    100920192 (GSK3B)
   05163 Human cytomegalovirus infection
    100920192 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100920192 (GSK3B)
   05165 Human papillomavirus infection
    100920192 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100920192 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100920192 (GSK3B)
   05020 Prion disease
    100920192 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100920192 (GSK3B)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100920192 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100920192 (GSK3B)
   04931 Insulin resistance
    100920192 (GSK3B)
   04934 Cushing syndrome
    100920192 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100920192 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100920192 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100920192 (GSK3B)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100920192 (GSK3B)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100920192 (GSK3B)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100920192 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100920192
NCBI-ProteinID: XP_031815561
LinkDB
Position
3
AA seq 444 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPLIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASEITNNNSSV
TSASSFSALECTFGPGDLSLTESI
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcagagagctgcaaaccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgacaacagtg
gtggcaactcctggacaaggtccagacaggccacaggaagtcagttatacagacactaaa
gtgatcgggaatgggtcgtttggtgtagtgtatcaagccaaactttgtgattcaggagaa
ctagttgctatcaaaaaagtactgcaggacaagagatttaagaacagagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtgga
gagaagaaagatgaagtatatcttaatctggtgctggactatgttcctgaaacagtatac
agagttgccagacactatagtcgggccaaacagacgctccctttgatctacgttaagttg
tacatgtatcaactgtttcgaagtttagcctatatccattcctttggaatctgtcatcgg
gatattaaaccacagaatctcttgcttgaccctgatacagctgtcctaaaactttgtgac
tttggaagtgcgaagcagctggttcgaggagagcccaatgtttcatatatctgctctcgc
tactatagagcaccagagttgatctttggagcaactgattacacctctagcatagatgta
tggtctgcgggatgtgtattggctgaactgttgctaggacaaccaatctttccaggagac
agtggtgtggatcagttggtggaaataatcaaggtcctgggaacaccaacacgagagcaa
attcgagaaatgaatccaaactacactgaattcaaatttcctcagattaaggcacatcct
tggactaaggactcgtcaggaacaggacatttcacctcaggagttcgggtcttccgaccc
cgaactccacctgaggcaattgcattatgtagccgtctgctggaatatacccctactgcc
cgattgacacccctggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaattaccaaatgggcgagatacacctgcactcttcaatttcaccactcaagaactg
tcaagtaatccacctctggctacaatccttattcctccccatgctcggattcaagcagct
gcttcaacccctacaaatgctacagcagcttcagaaatcaccaacaacaattcatcagtc
acatctgcaagttctttcagtgccctggaatgtacttttggacctggtgacttgagcctc
actgagagcatttag

DBGET integrated database retrieval system