KEGG   Sarcophilus harrisii (Tasmanian devil): 100920258
Entry
100920258         CDS       T02286                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04015  Rap1 signaling pathway
shr04371  Apelin signaling pathway
shr04390  Hippo signaling pathway
shr04514  Cell adhesion molecules
shr04520  Adherens junction
shr05100  Bacterial invasion of epithelial cells
shr05200  Pathways in cancer
shr05213  Endometrial cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100920258 (CDH1)
   04390 Hippo signaling pathway
    100920258 (CDH1)
   04371 Apelin signaling pathway
    100920258 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100920258 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100920258 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100920258 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100920258 (CDH1)
   05216 Thyroid cancer
    100920258 (CDH1)
   05218 Melanoma
    100920258 (CDH1)
   05219 Bladder cancer
    100920258 (CDH1)
   05213 Endometrial cancer
    100920258 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100920258 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100920258 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:shr04515]
    100920258 (CDH1)
   04090 CD molecules [BR:shr04090]
    100920258 (CDH1)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100920258 (CDH1)
Cell adhesion molecules [BR:shr04515]
 Cadherins
  Major cadherins
   100920258 (CDH1)
CD molecules [BR:shr04090]
 Proteins
  100920258 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2
Other DBs
NCBI-GeneID: 100920258
NCBI-ProteinID: XP_031805954
Ensembl: ENSSHAG00000011116
LinkDB
Position
2
AA seq 892 aa
MGTNRNWSLSLVSLLLLLQVSLWRCEDAGLCRSGFASESYTFEVSRAYLERGRILGQVNF
ESCSGRKLNAYFPEDSRFKVTPEGVVVVKRALHLYNLETSFNVYAWDAAGKKLSTKVTLK
KPLLHHQRHRVHQRQQVEESLPEEQREVMTFPPLRPVHRRQKRDWVIPPISCPENEKGPF
PKMLVQIKSNRDKETKVFYSITGQGADEPPQGVFIIERETGILKVTMPLDREHIAKYVLY
SHAVSSNGQPVEDPMEIVIRVTDQNDNRPEFTQEVFRGSVMEGAHPGTSVMQVSATDKDD
DVNTYNALIAYSILSQEPKAPHDSMFTINRRTGVISVVTTGLDRESIPEYTLIVQAADLD
GEGLSTTATAVITVTDTNDNPPIFNPTTYVGTVPENEVDAVITTLKVTDADVPHTPGWRA
VYSVQNDEKGLFVVTTNPETNEGILKTAKGLDFEAKQQYILHITVVNEIPFVVALPTSTA
TVTVDVLDVNEAPVFMPPVMKLEIPEDFEVGKKITAYTAQDPDKFLSQIITYRLWRDPAN
WLEVNPETGVIVTRDILDRENLEYVKNSTYTALIVAVDDGSPPATGTGTLLLLLSDVNDN
GPVPDPRKMDICQRDPEPQIINIIDPDLPPNTSPFTAELTHGASVNWTFSYNDDTRESLT
LRPKKELEIGEHKINLKLTDNQNKDQVTTLEVYVCDCEGAVSKCTKTGVIAQTGMGVPAI
LGILGGILVLLILLLLLLLFIRRRPAVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLS
QLHRGLDARPEVIRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSL
LVFDYEGNGSEAASLSSLNSSGSDEDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgggcactaatcggaactggtctctcagccttgtctctcttctcctgctgctgcaggtg
tcgttatggcgttgcgaggacgctgggctttgccgttcgggcttcgcctccgaaagttat
accttcgaggtgtcccgggcatacctggagcgaggccgaatcctgggccaagttaacttt
gaaagctgttctggaagaaagctgaatgcctattttcctgaggattcaagattcaaagtg
actcctgaaggtgttgtagttgtcaagagggctctacatctctacaatttagaaactagc
tttaatgtttatgcttgggatgctgcaggtaaaaaactctcaaccaaagtgacattaaag
aagccattactacaccatcaacgacaccgcgttcatcaacgccagcaagtagaggaatct
ctcccagaagaacaaagagaagtaatgacttttcctcctctccgccctgttcataggagg
cagaagagagattgggttattcctcctattagctgcccagaaaatgagaagggtccattc
cctaaaatgttggttcagatcaaatccaaccgagataaagagacaaaagttttctacagc
atcacagggcaaggagctgatgagcctccacaaggggtctttattattgaaagagaaacg
gggatcctgaaagtgacaatgcctttggacagagaacacattgccaaatacgtcctttac
tcccatgctgtgtcttcaaatggccaacctgtggaggatccgatggaaatagtgattaga
gtaacagatcagaatgacaatcgtcccgagtttacacaggaggttttcagagggtctgtg
atggaaggagctcatccaggtacctctgtcatgcaggtgtcagccactgataaggatgat
gatgtgaatacctacaatgctctgattgcttattccattctcagccaggaacccaaggca
ccccatgatagtatgttcaccattaaccggagaactggagtcatcagtgtggtcacaact
ggtctagacagagagagcatcccagaatatacactgattgtccaagctgctgacttagat
ggggaaggtttaagcaccacggccacagcggtgattacagtcacggatacaaatgacaat
ccccctatcttcaacccaaccacgtatgtgggaaccgtgcctgagaacgaagtggatgca
gtcattacaacgttgaaagtgaccgatgcggacgttcctcataccccaggatggagggca
gtctattctgtccaaaatgatgaaaagggtctctttgttgttaccaccaaccccgaaacc
aatgaaggaattttgaaaacggccaagggcttggattttgaggccaaacaacaatacatt
cttcatataacagtagtgaatgagattccatttgttgttgccctccctacctccacggcc
acagtcactgtggatgtcttggatgtgaacgaagcgccggtctttatgccaccagttatg
aaattggagattccagaggattttgaagtaggcaagaaaattacagcctacactgcacag
gatcccgacaagtttctgtcacagataataacgtatcgtttgtggagggatccagccaac
tggttggaagtaaatcctgagactggagtcattgttactcgggacattctggatagagag
aatttagagtatgtgaagaatagtacctacacggccctcatcgtggctgtggatgatggt
tctcctccagctacaggcacaggaacccttctattgcttctttctgatgtgaatgataat
ggcccagtaccagaccctcgaaaaatggacatttgccagagagatccagaacctcagatc
ataaatattattgatccagatcttccaccaaacacttctcctttcacagcagaattaaca
catggagctagtgttaactggactttttcatataatgatgatacaagagaatctctgact
ttgaggccaaagaaagaattagaaattggggaacacaagataaatctcaagctaacagac
aaccagaataaggaccaggtgaccaccttggaggtgtacgtgtgtgactgtgaaggggct
gtatccaagtgtacgaagacgggtgtaattgcccagaccggcatgggtgtaccggctatc
ctgggaatactaggaggaatcctggtactgctgattttactactgctcctgctcctcttt
atccgaagacggccagcagtgaaagagccattattgccacctgatgatgacacccgagac
aatgtctattattatgatgaggagggcggtggagaagaagaccaggactttgacctgagt
cagttgcaccgaggtctggatgctcgaccagaagtgatccgtaatgatgtagcaccaaca
ctcatgagcgtcccccagtatcgacctcgtccagcaaatccagatgaaattggcaatttc
attgatgagaacctgaaggctgctgacagtgaccccacagctcccccatatgactctcta
ctggtgtttgactatgaaggaaacggctctgaggcagcctccctgagctccctgaactct
tctggctccgacgaagaccaggattacgattacctgaatgaatggggcaatcgctttaaa
aagctggctgacatgtatggtggaggggaggatgactaa

DBGET integrated database retrieval system