KEGG   Sarcophilus harrisii (Tasmanian devil): 100920439
Entry
100920439         CDS       T02286                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04064  NF-kappa B signaling pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100920439 (GADD45B)
   04064 NF-kappa B signaling pathway
    100920439 (GADD45B)
   04068 FoxO signaling pathway
    100920439 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100920439 (GADD45B)
   04210 Apoptosis
    100920439 (GADD45B)
   04115 p53 signaling pathway
    100920439 (GADD45B)
   04218 Cellular senescence
    100920439 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100920439 (GADD45B)
   05202 Transcriptional misregulation in cancer
    100920439 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100920439 (GADD45B)
   05212 Pancreatic cancer
    100920439 (GADD45B)
   05225 Hepatocellular carcinoma
    100920439 (GADD45B)
   05226 Gastric cancer
    100920439 (GADD45B)
   05214 Glioma
    100920439 (GADD45B)
   05216 Thyroid cancer
    100920439 (GADD45B)
   05220 Chronic myeloid leukemia
    100920439 (GADD45B)
   05217 Basal cell carcinoma
    100920439 (GADD45B)
   05218 Melanoma
    100920439 (GADD45B)
   05213 Endometrial cancer
    100920439 (GADD45B)
   05224 Breast cancer
    100920439 (GADD45B)
   05222 Small cell lung cancer
    100920439 (GADD45B)
   05223 Non-small cell lung cancer
    100920439 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100920439 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100920439 (GADD45B)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100920439 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100920439 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100920439
NCBI-ProteinID: XP_003760856
Ensembl: ENSSHAG00000008384
UniProt: G3W2N1
LinkDB
Position
1
AA seq 160 aa
MTLEEVVACESAAQKMQTVSNAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEDEEDDIALQIHFTLIQAFCCDNDIDIVRVSGMRRLAELLGEPGPTEESEETRDLHCL
LVTNPHTDSWKSHGLVEVASYCEESRENNQWLPNISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccttggaagaagtcgtggcttgcgagagtgcggctcagaaaatgcagacggtgagc
aatgcggtggaggagttgctcgtagcggcgcagcgccaagaccgcctgacagtgggcgtg
tatgagtcggctaagctgatgaatgtggacccagacagcgtggtcctttgccttttggct
atcgatgaggatgaggaggatgacatcgccttgcagatccatttcacgttgatccaagcc
ttttgctgtgacaacgacatagatatagttcgggtgtctgggatgaggagactggccgag
cttctgggggagccggggcccacggaggagagcgaggagacccgggatctgcactgcctg
ctggtcacgaatcctcatactgattcatggaagagccatgggctggtagaagtggctagc
tactgtgaggaaagccgagagaacaaccagtggctccccaacatctccctccaggagcgc
tga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926902
Entry
100926902         CDS       T02286                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04064  NF-kappa B signaling pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100926902 (GADD45G)
   04064 NF-kappa B signaling pathway
    100926902 (GADD45G)
   04068 FoxO signaling pathway
    100926902 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100926902 (GADD45G)
   04210 Apoptosis
    100926902 (GADD45G)
   04115 p53 signaling pathway
    100926902 (GADD45G)
   04218 Cellular senescence
    100926902 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926902 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100926902 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100926902 (GADD45G)
   05212 Pancreatic cancer
    100926902 (GADD45G)
   05225 Hepatocellular carcinoma
    100926902 (GADD45G)
   05226 Gastric cancer
    100926902 (GADD45G)
   05214 Glioma
    100926902 (GADD45G)
   05216 Thyroid cancer
    100926902 (GADD45G)
   05220 Chronic myeloid leukemia
    100926902 (GADD45G)
   05217 Basal cell carcinoma
    100926902 (GADD45G)
   05218 Melanoma
    100926902 (GADD45G)
   05213 Endometrial cancer
    100926902 (GADD45G)
   05224 Breast cancer
    100926902 (GADD45G)
   05222 Small cell lung cancer
    100926902 (GADD45G)
   05223 Non-small cell lung cancer
    100926902 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100926902 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100926902 (GADD45G)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100926902 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100926902 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100926902
NCBI-ProteinID: XP_003762890
Ensembl: ENSSHAG00000004260
UniProt: G3VNU9
LinkDB
Position
1
AA seq 159 aa
MTLEEIHSQEMVTESTNRMQGAGKALSELLLSAQRQGCLTAGVYESAKVMNVDPDNVAFC
VLGADEEDEGDIALQIHFTLIQAFCCENDIDIVRVNNIQKLAEILGAHEDSGEPQDLHCI
LITNPNENSWKDPALEKLSLFCEESRNVNDWVPTITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactttggaagaaatccacagccaggagatggttaccgaaagcaccaataggatgcag
ggcgccgggaaagcattgagcgagctgctgttgtctgcccaacgccaaggctgtcttact
gcaggcgtatatgagtctgctaaagtcatgaatgtcgatccagataacgtggctttttgt
gtcctgggagcagatgaggaagatgagggtgacattgctctgcaaattcacttcactctc
atccaggctttctgttgtgaaaatgacatcgatattgttcgagtcaacaatattcagaag
ctggcagagattttaggtgctcatgaagattctggggaaccccaagatctacattgcatt
ttaattacaaatcccaatgagaattcctggaaagatccagctttagaaaaactaagcttg
ttctgtgaagagagccgaaatgtaaatgactgggtacccactatcactctgcctgaatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 116423727
Entry
116423727         CDS       T02286                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04064  NF-kappa B signaling pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116423727 (GADD45A)
   04064 NF-kappa B signaling pathway
    116423727 (GADD45A)
   04068 FoxO signaling pathway
    116423727 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    116423727 (GADD45A)
   04210 Apoptosis
    116423727 (GADD45A)
   04115 p53 signaling pathway
    116423727 (GADD45A)
   04218 Cellular senescence
    116423727 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116423727 (GADD45A)
   05202 Transcriptional misregulation in cancer
    116423727 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116423727 (GADD45A)
   05212 Pancreatic cancer
    116423727 (GADD45A)
   05225 Hepatocellular carcinoma
    116423727 (GADD45A)
   05226 Gastric cancer
    116423727 (GADD45A)
   05214 Glioma
    116423727 (GADD45A)
   05216 Thyroid cancer
    116423727 (GADD45A)
   05220 Chronic myeloid leukemia
    116423727 (GADD45A)
   05217 Basal cell carcinoma
    116423727 (GADD45A)
   05218 Melanoma
    116423727 (GADD45A)
   05213 Endometrial cancer
    116423727 (GADD45A)
   05224 Breast cancer
    116423727 (GADD45A)
   05222 Small cell lung cancer
    116423727 (GADD45A)
   05223 Non-small cell lung cancer
    116423727 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    116423727 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    116423727 (GADD45A)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     116423727 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     116423727 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 116423727
NCBI-ProteinID: XP_031824765
LinkDB
Position
4
AA seq 164 aa
MTLEEFAAGEQKTEGMDKVGDALEEVLSKALSQRSITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLGPGGAAAAAGAEPPPD
LHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 495 nt   +upstreamnt  +downstreamnt
atgactttggaagaattcgcggccggagaacagaaaacggaagggatggacaaggtcggg
gacgccctggaagaagttctcagcaaagccctgagtcagcgaagcatcacggtgggggtc
tacgaggcggccaaactgctcaacgtggaccccgataacgtggtgctgtgcctgctggcg
gccgacgaggatgacgaccgcgacgtggccctgcagatccacttcaccctgatccaggcc
ttctgctgcgagaatgacatcaacatcctgcgggtcagcaaccccgggcgcctggccgag
ctgctgctgctgggccccgggggcgcggcggcggccgcgggggccgagccgccgcccgac
ctgcactgcgtcctggtgacgaatccacattcctctcaatggaaggatccggccttgagt
caacttatatgtttctgccgggaaagccgatacatggatcagtgggtcccagtgattaac
ctccccgaacggtga

DBGET integrated database retrieval system