KEGG   Sarcophilus harrisii (Tasmanian devil): 100920942
Entry
100920942         CDS       T02286                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04110  Cell cycle
shr04114  Oocyte meiosis
shr04115  p53 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04934  Cushing syndrome
shr05161  Hepatitis B
shr05162  Measles
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05206  MicroRNAs in cancer
shr05215  Prostate cancer
shr05222  Small cell lung cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100920942 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100920942 (CCNE1)
   04114 Oocyte meiosis
    100920942 (CCNE1)
   04115 p53 signaling pathway
    100920942 (CCNE1)
   04218 Cellular senescence
    100920942 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100920942 (CCNE1)
   05206 MicroRNAs in cancer
    100920942 (CCNE1)
   05203 Viral carcinogenesis
    100920942 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100920942 (CCNE1)
   05215 Prostate cancer
    100920942 (CCNE1)
   05222 Small cell lung cancer
    100920942 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100920942 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100920942 (CCNE1)
   05161 Hepatitis B
    100920942 (CCNE1)
   05162 Measles
    100920942 (CCNE1)
   05169 Epstein-Barr virus infection
    100920942 (CCNE1)
   05165 Human papillomavirus infection
    100920942 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:shr03032]
    100920942 (CCNE1)
   03036 Chromosome and associated proteins [BR:shr03036]
    100920942 (CCNE1)
DNA replication proteins [BR:shr03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100920942 (CCNE1)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100920942 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100920942
NCBI-ProteinID: XP_031810262
LinkDB
Position
2
AA seq 746 aa
MSRESSSEECHEKDEFAQDGKEDHVDEKEEPNSDELVNGKEEPSHDELMNGTQERSPDVL
MNGTHEPSPDELFDGEEDPSIDELVYGDDPSFDEVIYEEEDPNPNELVCEEEGASLDELV
CEEEGASLDELVCEEEDASLDELVCEEEDPHADDLICEEEDPIPDELMCDEEDAVEEEDA
SPEELICDEEYPNADELICEEEDPNSDDLICEEEDPHPDDLICEEEIPHPDEDDFICEEE
DPNPIDLICEEEDPSFHELICGEQDPSLHELFDGRDEPRPNARENPSPDGREDPRPDGRE
DPNLDARQDPSAGELFDGQNDQSPSEHTERMGERSPDGKEDQWNGKEEENMKRVNESRKE
QSGSSSTESSRSRKRKADVAVFLLDPDEVLAKRETIGRTAVRIPAFLRNPWSVILTPDKG
WDEPSLPNSNMPTHNFSQHRATPLPLLGWANRDEVWKIMLSKEQVYLRDKNFMERHPSLQ
PRMRSILLDWMMEVSEVYKLHRETYYLAQDFFDRYMATQRNITKTLLQLIGITSLFIAAK
LEEIYPPKLYQFAYVTDGACTEEEILTMELIIMKALKWRLSPMTLVSWLNVYMQVAYLND
LYEEVLMPQYPQQIFVQVAELLDVCILDMGCFDFTYGVLAASALYHFSSTEIMKKVSGFD
WPEVEECVKWMVPFAMAVKEVGGARLKYFKGVPSEDMHNIQTHVNTINLLDKAYEKQAML
ADERVSVPNGLLTPPPSDKKPSKEQE
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgtccagagaaagtagttctgaggaatgccacgagaaggatgaatttgcccaggatggg
aaggaagatcatgttgatgagaaggaagaaccaaactccgatgaacttgtgaatggaaag
gaagaaccaagccatgatgagcttatgaatggtacacaggagcggagccccgatgtgctt
atgaacggtacacatgagccaagtcctgatgagctctttgatggggaagaagacccaagt
attgatgagcttgtttatggcgatgatccaagctttgatgaagttatctatgaagaggaa
gatccaaaccccaacgaacttgtttgtgaagaggaaggtgcaagcttagatgagcttgtc
tgtgaggaggaaggtgcgagcttagatgagcttgtctgtgaggaagaagacgctagctta
gatgagcttgtctgtgaggaagaagatccccatgccgatgacctgatctgtgaagaggaa
gatcccatccctgatgagcttatgtgtgatgaagaagatgccgttgaggaggaagatgcc
agtcctgaggagcttatctgtgatgaagaatatcccaacgcagatgaacttatttgtgag
gaagaagacccaaactcagatgatcttatctgtgaggaagaagacccacaccctgatgat
cttatttgtgaggaggaaatcccacaccctgatgaggatgactttatttgtgaggaggaa
gacccaaatcctattgatctcatctgtgaggaagaagatccaagttttcatgagcttatc
tgtggggaacaagatccaagtctccatgaactttttgatgggagggatgagccaagacca
aatgcaagggaaaatccaagccctgacggcagggaagatccaagacctgatggcagggaa
gaccccaatcttgatgccaggcaagatccaagtgctggtgagctctttgacggacagaat
gatcaaagtcccagtgagcatactgaaaggatgggggaaagaagccctgatgggaaggaa
gatcagtggaatgggaaagaagaagagaacatgaaaagggtaaatgagtctagaaaagag
caaagtggcagcagctcaacagaatcctctcgatcccggaaaagaaaggcagatgtagct
gtgtttttgctggacccagatgaagttttggccaaaagagaaacaattggaagaactgca
gtcaggataccggcttttctcagaaatccatggtcagtgattcttacacctgataaagga
tgggatgagccatccttacctaattctaatatgccaacccacaacttttcacaacataga
gctacaccattaccattattgggctgggcaaatagagatgaagtttggaaaatcatgtta
agcaaagaacaagtatatctgagggataagaactttatggagagacatccttctctccag
ccaagaatgcgatccatccttctggattggatgatggaggtgtctgaagtctataaactt
cacagggagacatattacttggcccaagacttctttgatcgatatatggcaacacagcga
aatattacaaaaacacttttgcagcttattgggattacctcattatttatagctgccaaa
cttgaggaaatctatccaccaaagctgtaccagtttgcttatgtgaccgatggagcttgt
acagaggaagaaattcttaccatggaattaatcattatgaaggcccttaagtggcgttta
agtccaatgacacttgtgtcctggctaaatgtatatatgcaggttgcttatctcaatgac
ctgtatgaagaagtacttatgccacagtatcctcagcaaatctttgtgcaggttgctgag
cttttagatgtctgcatcctggatatgggctgctttgattttacttatggagtgctggct
gcctctgccttatatcatttctcttccactgagataatgaaaaaagtttcaggctttgat
tggccagaagtagaggagtgtgtgaaatggatggtcccatttgctatggctgtaaaggaa
gtaggaggagccagactcaaatattttaagggtgtgcctagtgaagacatgcataacatt
cagactcatgtgaacaccataaatttgctggacaaagcttatgaaaaacaagccatgttg
gctgatgagagagtgtctgttcccaatggactcctcacaccacctccgagtgataagaaa
cctagcaaagagcaggagtga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100924454
Entry
100924454         CDS       T02286                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04110  Cell cycle
shr04114  Oocyte meiosis
shr04115  p53 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04934  Cushing syndrome
shr05161  Hepatitis B
shr05162  Measles
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05206  MicroRNAs in cancer
shr05215  Prostate cancer
shr05222  Small cell lung cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100924454 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100924454 (CCNE2)
   04114 Oocyte meiosis
    100924454 (CCNE2)
   04115 p53 signaling pathway
    100924454 (CCNE2)
   04218 Cellular senescence
    100924454 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100924454 (CCNE2)
   05206 MicroRNAs in cancer
    100924454 (CCNE2)
   05203 Viral carcinogenesis
    100924454 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100924454 (CCNE2)
   05215 Prostate cancer
    100924454 (CCNE2)
   05222 Small cell lung cancer
    100924454 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100924454 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100924454 (CCNE2)
   05161 Hepatitis B
    100924454 (CCNE2)
   05162 Measles
    100924454 (CCNE2)
   05169 Epstein-Barr virus infection
    100924454 (CCNE2)
   05165 Human papillomavirus infection
    100924454 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:shr03032]
    100924454 (CCNE2)
   03036 Chromosome and associated proteins [BR:shr03036]
    100924454 (CCNE2)
DNA replication proteins [BR:shr03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100924454 (CCNE2)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100924454 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Tim54
Other DBs
NCBI-GeneID: 100924454
NCBI-ProteinID: XP_003760300
Ensembl: ENSSHAG00000017844
LinkDB
Position
1
AA seq 516 aa
MAPGSHLSGLMGVTSQTSLSASSPTSSEPPYSCHTLGSDRVPEGGGAGGESWREMPGSER
RAEEGVSSSVPLLAPGPRVWDPQPATAGTLCVEEKDPARRDPEALKNPKKKMSRRSSRLQ
AKQQPQSNQTDSPQETQFLQAKKRKTAQDVKKKKEETVAKRQQYEIRNCWPSVISGGITP
CIIIETPHKETVTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWFNMLKKETKYVHDK
HFEMLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLI
GITSLFIASKLEEIYAPKLQEFAYVTDGACSEDDILGMELIILKALKWELCPVTVIAWLN
VFLQVDALKDVPKVLLPQYSQEKFVQIAQLLDLCILSIDSLEFQYRILAAAALCHFTSIE
VVKKASGLDWDNISECVEWMVPFARVVKGGPPVKLKVFKKISVEDRHNIQTHTNYLAMLE
EVNYVSAFTKVGQLSPVCNGGIMTPPKSTEKSPGKH
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggccccggggtcgcacctctcgggtttgatgggtgtcacttctcagaccagcctatcc
gcttcttcccccacctcctcggagcctccttacagttgccacaccctcgggtcagaccgc
gtcccagagggcggaggggcgggaggagagtcctggcgggagatgccggggtcggagagg
agggccgaagagggagtctcctcctcagttcccttgctagccccagggcccagggtctgg
gacccgcagcctgcgaccgccggcactctatgcgtagaggaaaaggacccggcaaggcgg
gatccagaagctttgaagaacccaaagaaaaaaatgtcaagaaggagtagccgtttgcaa
gctaagcagcagccccagagcaatcaaacagattctccccaggaaactcaattccttcaa
gccaaaaaaaggaaaacagctcaggatgtaaagaaaaaaaaagaggagactgtggccaag
aggcagcaatatgaaattaggaattgttggccatctgtaatatctgggggtatcactcct
tgcattattattgaaacaccacacaaagaaactgtcaccagtgacttctccagatttact
aattataggtttaaaaaccttttcataaatccttcacctctgcctgatctaagttgggga
tgttctaaggatgtctggtttaatatgttaaaaaaggagaccaaatatgttcatgacaaa
cattttgaaatgctacattctgacttagaaccacagatgaggtcaatacttctggactgg
cttttagaggtatgtgaagtatatacacttcacagagaaacattttatcttgctcaagat
ttttttgatagatttatgttgacacaaaaagatataaacaaaaatatgcttcagctcatt
ggtattacctcattattcattgcttcaaaacttgaggaaatctatgcacctaaattacaa
gaatttgcttatgtcactgatggtgcttgcagtgaagatgatatcctagggatggaactc
attatattaaaggctttaaagtgggagctctgtccagtaacagttattgcctggctgaat
gtctttctccaagtcgatgctctaaaagatgttcctaaagtactcctacctcagtattcc
caggaaaagttcgttcaaatagcccagctcctggatctgtgtattctctccattgattca
ttagaattccagtacagaatattggctgcagctgctttatgccattttacctctattgaa
gtcgttaagaaagcttcaggtttagactgggataatatttcagaatgtgtagaatggatg
gtaccttttgccagagtagtgaagggtggtcctccggtgaaactgaaggtttttaagaag
atttctgtagaagacagacacaatatccagacacacacaaattacttggctatgctggag
gaagtcaattatgtgtcagctttcacaaaagtgggacagttgtcaccagtgtgtaatgga
ggtatcatgacaccaccgaagagcacagaaaaatccccaggaaaacactaa

DBGET integrated database retrieval system