KEGG   Sarcophilus harrisii (Tasmanian devil): 100923576
Entry
100923576         CDS       T02286                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04310  Wnt signaling pathway
shr04390  Hippo signaling pathway
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04934  Cushing syndrome
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05217  Basal cell carcinoma
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100923576 (AXIN1)
   04390 Hippo signaling pathway
    100923576 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100923576 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923576 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100923576 (AXIN1)
   05225 Hepatocellular carcinoma
    100923576 (AXIN1)
   05226 Gastric cancer
    100923576 (AXIN1)
   05217 Basal cell carcinoma
    100923576 (AXIN1)
   05213 Endometrial cancer
    100923576 (AXIN1)
   05224 Breast cancer
    100923576 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100923576 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100923576 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100923576 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100923576 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100923576 (AXIN1)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100923576 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 100923576
NCBI-ProteinID: XP_031801556
Ensembl: ENSSHAG00000003838
LinkDB
Position
1
AA seq 875 aa
MNVQEQGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPVSHSFYFGKGDGIKNETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDSADLLDFWFA
CSGFRKLEPCDSNEEKRLKLAKAIYRKYILDSNGIVSRQTKPATKSFIKDCIMKQHIDPA
MFDQAQTEVQSMMEDNTYPLFLKSDIYLEYTRTGLESPKIFSDQSPGSGTGKGIPGYLPT
LNEDEEWKCDQDTEEDHGRDSAPASRLTQKLLMETAPQRASSNRRYNESREFRHGSWREP
VNPYYVNSGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGVPPYRTRKQHRREMQESV
KANGRVPLPHIPRTYRMPKEIRVEPQKFAAELINRLEAVQRTREAEEKLEERLKRVRAEE
EGEDANVSSGPSVVSHKLPSAQTLHHFPPRYGDMGCAGIRDVHEENPESILDEHVQRVMK
TPGCQSPGPGHHSPKPRSPDNGHAAKIPGTLGTGPPGHSKHSTKSGMKLDAANLYHHKHV
YHHIHHHSVMKPKEQIEAEATQRVQNSFAWNAESHNYATKSRNYNESMGLASNPVDALGY
SGKTSMLSKRNSKKADSGKSAGPNYEMPGSPEDVEKNQKIMQWIIEGEKEISRHKKTNHG
SSGTKKQSGHDSSRPLSIERPGAVHPWVSAQLRNVVQPSHLFIQDPTMPPNPAPNPLTQL
EEARRRLEEEEKRAGKLPTKQRYVQEVIQRGRSSVRPACMPMLHVVPAVSDMDLSESEAK
LQKKLGNSSAPPCDTIVVAYYFCGEPIPYRTLVKGRVVTLGQFKELLTKKGNYRYYFKKV
SDEFDCGVVFEEVREDDAILPIFEEKIIGKVEKVD
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgaatgtccaagaacagggtttccccttggaccttggtgggagcttcactgaagatgct
cccaggcccccagttcctggtgaggaaggtgaactggtttccacagatcccagaccagtc
agccacagcttttattttgggaaaggcgatgggattaaaaatgaaacttccacggccacc
ccgaggcgatcagatctggatttggggtatgagcctgaaggaagtgcttcacctacaccc
ccatatttgaaatgggctgagtcattgcattctttgctggatgatcaagatggaataaat
ctatttaggactttcttgaagcaagaagactctgcagatttgttagacttctggtttgcc
tgcagtggctttaggaaattggagccctgtgactccaatgaagaaaagaggcttaagttg
gcaaaagctatttacagaaaatacattcttgatagtaatggtatcgtatctcgtcagact
aaaccagctacaaagagcttcataaaagattgcatcatgaagcaacatattgatcctgcc
atgtttgaccaggcccaaactgaggttcaatccatgatggaggataacacctaccccttg
ttccttaaatcagatatttatttggaatacacgaggacgggtttggaaagccctaaaatc
tttagtgatcaaagccctgggtcagggacggggaaaggtatacctggatatttgcccact
ttgaatgaggatgaggaatggaagtgtgaccaagacacagaagaagatcatggcagagat
tcagctccagccagcaggctaactcagaagttactaatggaaacagcaccccaacgggcc
tcatcaaataggagatacaatgaaagcagagaatttaggcatggttcatggagggaacct
gtcaacccttactatgtcaattctggttatgcccttgcaccagccaccagtgctaatgat
agcgaacagcagagtatgtccagtgatgccgacacaatgtccctcactgatagcagtgta
gatggagtacctccttacagaacccgaaagcaacatcgaagagagatgcaggaaagtgtc
aaagccaatggacgggtaccactacctcacattcctcgtacttatcgaatgccaaaggaa
atccgtgttgaaccacaaaagtttgcagcagagcttatcaatcggttggaggctgtccag
cggacaagggaagcagaggagaaattagaagagcgtctaaaacgtgtccgagcagaagaa
gaaggcgaagatgcaaatgtctcttctggtccttcagtagttagtcacaagctgccttct
gcgcagaccttgcaccatttccctccccgttatggagatatgggctgcgctgggatacga
gatgtccatgaggaaaatcctgagagcatccttgatgagcacgtacagagggtcatgaag
acaccaggttgccaatcccctggacctggccaccattccccaaagccacgctccccagac
aatggtcatgcagctaagattccagggacactgggtacaggacctcctggacatagcaaa
cacagtacaaaatcaggaatgaaactagatgcagctaatttataccatcacaaacatgtc
taccaccacattcatcaccacagtgtgatgaaaccaaaagagcagattgaggctgaagcc
actcaaagggttcagaacagctttgcttggaatgcagagtcacataactatgcaaccaaa
tctcgaaactacaatgaaagcatggggctagcttcaaatccagtggatgcattgggctat
agtggcaaaactagtatgctctcaaaaagaaattcaaagaaagccgattcagggaaaagt
gctggtcccaactatgaaatgcctgggtctccagaagatgtggagaagaaccagaaaatc
atgcagtggataattgaaggagaaaaggaaatcagcaggcataaaaaaacaaaccatggg
tcttcagggactaaaaagcaatcgggccatgatagttccagacccctttccattgagcgt
cctggtgctgtccatccttgggtgagcgctcagctccggaatgttgtccaaccttctcat
cttttcatccaagaccccacaatgccacctaacccagcaccaaaccccctgactcaactg
gaagaagcccgaaggcgcctggaagaagaagagaaaagagctggaaaactgcctaccaag
cagaggtatgtgcaagaggttatccagcggggtcgctcttctgtcaggccagcttgtatg
ccaatgctgcatgtggtaccagctgtctccgacatggacctctccgagtctgaggcaaag
ctccagaagaaattggggaatagcagtgccccaccatgtgataccattgttgtagcttat
tacttctgtggagagccaatcccttataggaccttggtcaaggggcgtgtggtcaccctg
ggtcaattcaaagagctgctgactaagaaagggaactacagatattacttcaagaaagtg
agtgatgaatttgactgtggggttgtgtttgaggaagttcgagaagatgatgccatcttg
cccatttttgaagagaagatcattgggaaagtggagaaagttgattaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100933740
Entry
100933740         CDS       T02286                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04310  Wnt signaling pathway
shr04390  Hippo signaling pathway
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04934  Cushing syndrome
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05217  Basal cell carcinoma
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100933740 (AXIN2)
   04390 Hippo signaling pathway
    100933740 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100933740 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100933740 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100933740 (AXIN2)
   05225 Hepatocellular carcinoma
    100933740 (AXIN2)
   05226 Gastric cancer
    100933740 (AXIN2)
   05217 Basal cell carcinoma
    100933740 (AXIN2)
   05213 Endometrial cancer
    100933740 (AXIN2)
   05224 Breast cancer
    100933740 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100933740 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100933740 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100933740 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100933740 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100933740 (AXIN2)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100933740 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind DUF4827 GILT
Other DBs
NCBI-GeneID: 100933740
NCBI-ProteinID: XP_003768617
Ensembl: ENSSHAG00000005565
LinkDB
Position
4
AA seq 838 aa
MSSAMLVTHISDPSSSFREDAPRPPVPGEEGETPSCQQSVHLSQGKSPVIKTMSISSNTR
RNEDGLGEPEGRASPDSPLARWTKSLHSLLGDQDGAYLFRTFLEREECVDTLDFWFACNG
FRQMNLKDTKTLRVAKAIYKRYIENNCIVSKQLKPATKTYIRDSIKKQQIDSTMFDQAQT
EIQTVMEENAYQMFLTSDIYLEYVRSGGENPAYINNSGLGSLKVVCGYLPTLNEEEEWSC
EDFKGKVLPTVVGLSSKTLRATANVRSTEAIENGYRSFKRNDPINPYHVSSGHVFAPAAS
ANDSEISSDALTDDSMSMTDSSVDGIPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTH
RLPKEMTPIEPAIFAAELISRLEKLKQEQESLDSLEERLQQIKEDEEKEGSELPVNTREI
AAQHPLSLLPSGSYEEDPQAILDDHLSRVLKTPGCQSPGMGRHSPRSHSPDHHHHYHPLL
QPSGRLPPPAAGSALCPLGKSFVTKQMTKHVYHHYIHHHTIPKTKEQIEVEAAQKVQCFC
LGGTDYYLCSKCKSHSKGPDLVPVEQFSSRSNTLSKRNGKVTEPCLALSAKEGVPVGTGL
LQLPGNEGDRSQNVWQWMLESERQNKHKPHSAQNTKKGYSLESARGALGDRATRPHLWGG
NIGHSRTMPHAHPFAQDSGMASLGPPNTLAQLEEACRRLAEVSKPQKQRCCTSNQQKDRN
HSTVGHVGGSSFCNPSLAPEDHREPKKLASVHSLQTTELVVTYFFCGEEIPYRRMLKAQS
LTLGHFKEQLSKKGNYRYYFKKASDEFDCGAVFEEIWEDDTILPMYEGRILGKVERID
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgagtagtgctatgttggtgactcatatctcagaccccagcagtagcttcagagaagac
gctcctcgacccccagtgccaggagaagaaggagagacaccatcatgccagcagtctgtc
cacctcagtcagggcaagagcccagtcatcaaaactatgtctatttcttccaacactagg
aggaatgaagatggcttgggagagcctgaaggcagggcatccccagactcccctctggcc
aggtggaccaagtctttacattccttgttgggtgatcaggatggggcttatctttttcgg
actttcctggagagggaagagtgcgtggataccttagacttttggtttgcctgcaatgga
ttcaggcagatgaaccttaaggacaccaaaacgttaagagtagccaaagcaatttacaaa
aggtacatcgaaaataactgtattgtttccaagcaactgaaaccagccaccaagacctac
ataagagatagcattaagaaacagcagatagattcaaccatgtttgatcaagctcagact
gagattcagactgtgatggaggaaaatgcctaccagatgtttttgacttctgatatatac
ctcgaatatgtaaggagtgggggagaaaacccagcttatattaacaacagtgggcttgga
agtttaaaggtagtctgtggctatctccccaccttaaatgaagaagaggagtggagctgt
gaggactttaaaggcaaggttttgcctacagtggttggcctgtccagcaaaactctaagg
gctacagcaaatgtgagatccacagaagctattgaaaatggatacagatccttcaagagg
aacgatccaattaatccatatcacgtaagctctggccatgtctttgctccggcagctagt
gccaatgacagtgaaatctccagtgatgcgctgaccgatgactccatgtctatgacggac
agtagtgtagatggaatccctccttacagaatggggagcaagaaacagctacagagagaa
atgcatcgcagtgtgaaggccaatggccaagtttctctacctcatttcccgagaactcac
cgcctgcctaaggagatgacacccattgaaccggccatttttgctgcagagttgatctct
cgactggagaagctcaaacaggaacaggaaagtttggacagtctggaggagaggctgcag
caaatcaaggaggatgaagagaaggaggggtcggagttaccagtcaacactcgggagata
gctgcccagcacccactttcccttttaccatctggcagctatgaagaagacccacaagct
atcctagatgaccacttatcaagggtgctgaagactcctggctgccagtccccaggcatg
gggcggcacagtccccgctctcattcccctgaccaccatcaccactatcaccccctactc
caacccagtggtcgtctgccacccccagcagctgggtcagctctctgcccacttggcaaa
agttttgttacaaagcagatgactaaacacgtataccaccactacatccaccatcacacc
atccctaaaaccaaggagcagattgaagtggaggcagctcagaaggtgcagtgcttctgc
cttggtggcacagattattatttgtgctcgaaatgcaagagtcactccaagggaccagac
ctggtaccagtggagcagtttagcagccgaagtaataccttatcaaagcggaatgggaaa
gtgacagaaccgtgtttggccttgtcagccaaggaaggagtccctgttgggacagggcta
ctgcaactgcctgggaatgagggagacaggtcacagaatgtctggcagtggatgttggag
agcgagagacagaacaaacacaagcctcatagtgcccagaacacaaaaaaaggctactcc
ctggagtcagcccggggagctcttggtgatcgagctacccgccctcatctgtggggaggt
aacattgggcattcccgcaccatgccacatgcccatccctttgcacaagactctggcatg
gcttcccttggtccccctaacaccctggctcagctagaggaggcttgtcgtcggttggct
gaagtgtccaagccccaaaagcaacggtgctgtacatcaaatcaacagaaggatagaaac
cactctactgttggccacgtgggagggtcttccttctgcaatcccagtctagccccagaa
gatcacagagagccaaagaaactggcaagtgttcactcccttcagaccactgaactggtc
gtcacttattttttctgtggagaagaaattccgtacaggaggatgttgaaggcgcagagt
ctgacacttggccactttaaagagcagctcagcaaaaagggaaattataggtattatttc
aaaaaagcaagtgacgagtttgactgtggagctgtttttgaagagatttgggaagatgat
acgatacttccaatgtacgaaggaaggattctggggaaagtcgaaagaattgattaa

DBGET integrated database retrieval system