KEGG   Sarcophilus harrisii (Tasmanian devil): 100928770
Entry
100928770         CDS       T02286                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04915  Estrogen signaling pathway
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100928770 (TGFA)
   04012 ErbB signaling pathway
    100928770 (TGFA)
   04014 Ras signaling pathway
    100928770 (TGFA)
   04151 PI3K-Akt signaling pathway
    100928770 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100928770 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928770 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100928770 (TGFA)
   05212 Pancreatic cancer
    100928770 (TGFA)
   05225 Hepatocellular carcinoma
    100928770 (TGFA)
   05214 Glioma
    100928770 (TGFA)
   05211 Renal cell carcinoma
    100928770 (TGFA)
   05215 Prostate cancer
    100928770 (TGFA)
   05223 Non-small cell lung cancer
    100928770 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100928770 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 UPF0560 TMEM154
Other DBs
NCBI-GeneID: 100928770
NCBI-ProteinID: XP_023350457
LinkDB
Position
2
AA seq 160 aa
MVTPAGELALIGIGILLAVCQALENTTSALNAGPPMAAAVVSHFHDCPDSHSQFCFHGTC
RFLVEEEKPACKCHSGYVGARCEHADLLAVVAANQKKQTITALVVVSIVALVVLIGICVL
IHCCRIRRPCEWCRGFVCQHEKPSDLLKGGTTCCRSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggttactccggcgggggagcttgcactgatcgggataggtattttattggccgtgtgc
caggctttggagaatacaacatctgccttgaatgcaggtccccctatggcagctgcagtg
gtttcacattttcatgactgtccagattcccacagtcagttctgctttcatgggacctgc
aggtttttggtggaagaggagaaaccagcgtgtaaatgccattctgggtatgttggggca
cgatgtgaacacgcggatctccttgcagtagtggcagccaatcagaagaaacagaccatc
actgccctggtggtggtttccatagtagccttggttgtccttattgggatctgtgtactt
atacactgctgtcgaataaggaggccttgtgaatggtgtcggggctttgtctgtcaacat
gagaagcccagtgacctcttgaagggaggaacaacctgttgccgctcagagacagtggtc
tga

DBGET integrated database retrieval system