KEGG   Sarcophilus harrisii (Tasmanian devil): 100928834
Entry
100928834         CDS       T02286                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928834 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100928834 (RARB)
   05222 Small cell lung cancer
    100928834 (RARB)
   05223 Non-small cell lung cancer
    100928834 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100928834 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:shr03310]
    100928834 (RARB)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100928834 (RARB)
Nuclear receptors [BR:shr03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100928834 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100928834
NCBI-ProteinID: XP_003772080
Ensembl: ENSSHAG00000009801
UniProt: G3W7J4
LinkDB
Position
5
AA seq 517 aa
MTIRINYRLLAVLSVIIHDSALGKRPAAQRAKKGAELDGVGWTSPVPPASPPLEEKALLQ
TFSRERGETMFDCMDVLAVSPGQILDFYTASPSSCMLQEKALKACFSGLTQSEWQRRHTA
QSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQK
NMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDKNKKKKEPSKQEFTESY
EMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEA
LKIYIRKRRPNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSE
GHEPLTPSSSGNTAEHSPSISPSSVENSGVGQSPLVQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgaccattcggatcaattacaggcttttagcggtgttgtctgtcataattcatgattcg
gctctgggaaaaagaccagcagcccagcgtgccaagaaaggggcagagttggatggagtt
gggtggacttctcccgtgcctcctgcctctccacccctagaggagaaagcacttttgcag
acattcagtagagagaggggagagaccatgtttgactgtatggatgttctcgcagtgagc
cctgggcaaatcctggacttctatactgcgagcccgtcttcttgcatgctccaggagaaa
gccctcaaagcatgcttcagtggattgacacaatcagagtggcagcgccggcacactgct
caatccatcgaaacacaaagcaccagttctgaggagcttgtccccagccctccttctcca
ctccctcctcctcgtgtttacaagccctgcttcgtatgccaggataagtcatctggctac
cactatggggtcagcgcttgcgagggatgtaagggctttttccgcagaagtattcagaag
aacatgatttatacttgccaccgagataagaactgtgtgattaacaaagtcaccaggaac
cgttgccagtactgccgcctccagaagtgctttgaagtggggatgtccaaagaatctgtc
agaaatgataagaataaaaagaagaaagagccttcgaagcaggaattcacagaaagctat
gagatgacagcagaattggatgatctcaccgaaaaaatcaggaaagctcaccaggaaacc
ttcccatcgctctgccagctggggaaatacaccacgaattccagcgccgatcaccgtgtg
cgcctggacctgggcctctgggacaagttcagcgagctggccaccaagtgcattatcaaa
atcgtggagttcgccaagaggttgcccggcttcaccggcctgaccatcgccgatcagatc
acgctcctgaaggccgcctgcctcgacatcttgattcttagaatctgcacaagatacaca
cctgaacaagacacgatgaccttttctgacggccttaccttaaaccgaacccagatgcac
aatgccggctttggacctctcaccgatctggtgttcacctttgccaatcagctcctgcct
ttggaaatggatgacacagaaacgggccttcttagtgccatctgcttaatctgtggagat
cgtcaggacttagaggaaccaacaaaagtggacaagctacaagaaccattgctggaagca
ctgaaaatttacatcagaaagaggcgacccaacaagcctcatatgtttccaaagatccta
atgaaaatcacagatctccgtagcattagtgcaaaaggtgcagaacgtgtgattaccttg
aaaatggaaatccctggctcgatgccccctctcattcaggaaatgctggagaattctgaa
ggacatgaacctctgacaccaagttctagtggcaatacagcagagcacagtcctagcatc
tcacccagctccgtggagaacagtggggttgggcagtccccactggtgcaataa

DBGET integrated database retrieval system