KEGG   Sarcophilus harrisii (Tasmanian devil): 100930636
Entry
100930636         CDS       T02286                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04015  Rap1 signaling pathway
shr04310  Wnt signaling pathway
shr04390  Hippo signaling pathway
shr04510  Focal adhesion
shr04520  Adherens junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04670  Leukocyte transendothelial migration
shr04916  Melanogenesis
shr04919  Thyroid hormone signaling pathway
shr04934  Cushing syndrome
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05100  Bacterial invasion of epithelial cells
shr05132  Salmonella infection
shr05160  Hepatitis C
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100930636 (CTNNB1)
   04310 Wnt signaling pathway
    100930636 (CTNNB1)
   04390 Hippo signaling pathway
    100930636 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100930636 (CTNNB1)
   04520 Adherens junction
    100930636 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100930636 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100930636 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100930636 (CTNNB1)
   04916 Melanogenesis
    100930636 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100930636 (CTNNB1)
   05205 Proteoglycans in cancer
    100930636 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100930636 (CTNNB1)
   05225 Hepatocellular carcinoma
    100930636 (CTNNB1)
   05226 Gastric cancer
    100930636 (CTNNB1)
   05216 Thyroid cancer
    100930636 (CTNNB1)
   05217 Basal cell carcinoma
    100930636 (CTNNB1)
   05215 Prostate cancer
    100930636 (CTNNB1)
   05213 Endometrial cancer
    100930636 (CTNNB1)
   05224 Breast cancer
    100930636 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100930636 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100930636 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100930636 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100930636 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100930636 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100930636 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    100930636 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100930636 (CTNNB1)
   05163 Human cytomegalovirus infection
    100930636 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100930636 (CTNNB1)
   05165 Human papillomavirus infection
    100930636 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100930636
NCBI-ProteinID: XP_031795924
Ensembl: ENSSHAG00000008460
LinkDB
Position
5
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMTWNETADLGLDIGAQGEPLGYRPDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggccactcaagctgacttgatggaattagacatggcgatggagccagatagaaaagca
gctgttagccactggcagcaacaatcttaccttgattctggaatccattctggtgccaca
acaacagctccctccctgagtggcaaaggaaatcctgaggaggaagatgtggataccacc
caagtcttatatgaatgggaacagggattttctcagtctttcacacaggaacaggtagct
gatattgatggacagtacgccatgaccagagcacagagagttcgagctgccatgttccct
gaaaccttggatgagggcatgcagatcccatccactcagtttgatgcagctcacccaact
aacgttcagcgtctggctgaaccttcccagatgctaaagcatgctgtggtgaatttgatc
aattaccaggatgatgccgagctggccactcgtgcaattcctgaattgactaaactgctg
aatgatgaggatcaggtggtagttaataaggctgcagttatggttcaccaactatctaag
aaagaagcctccagacacgccataatgcgctctcctcagatggtgtctgctattgtgcgc
accatgcaaaatacaaatgatgtagaaacagcacgttgtactgctggaacactgcacaat
ctttcccatcaccgtgaaggcttattggctatctttaagtctgggggcattcctgccctt
gtgaaaatgcttggctccccagtggactctgtgttgttttatgctatcacaactctccac
aatcttttattacatcaagaaggagccaaaatggcagtgcgtcttgctggtggactgcag
aaaatggttgctttgctcaataaaacaaacgttaagttcttggctatcacaacagactgt
cttcagattttggcttatggcaatcaggaaagcaaactgatcattttggctagtggtggg
ccccaggctctggtaaatataatgaggacttatacttatgaaaaactcctatggaccaca
agtagagtactgaaagtgttgtcagtctgctctagtaacaaaccggctatcgtggaagct
ggtgggatgcaagcgttaggacttcaccttacagatccaagtcagcgtctcgtacagaat
tgtctctggactcttaggaatctttcagatgctgcaactaaacaggaaggaatggaaggt
cttctagggactctggttcagcttttaggctcagatgatataaatgttgtcacctgtgct
gctggcatcctttctaacctcacttgcaataactataagaacaagatgatggtgtgccaa
gttggtggaattgaagccctcgttcgcactgttcttcgtgctggtgatagggaggatatc
actgaacctgccatctgtgcacttcgtcatttgactagcagacaccaggaggctgagatg
gcgcagaacgccgtccgcctccattatggactcccagtggtggttaagctcttacatccg
ccatcacattggccgctgataaaggcaactgttggtctcatccgaaatcttgccctttgc
ccagcgaatcacgcacctttacgtgagcaaggtgcaattccccggttagttcaattgttg
gtgagagcacatcaggacacccagcgccggacttcaatgggtggaacacagcaacagttt
gtggagggagtgcgcatggaggagatcgtggagggctgcactggcgcccttcacatcctg
gcgcgagatgtccacaaccggatcgtcatcaggggcctgaacaccattccactgtttgtg
cagttgctgtattcccctattgagaacatccagagagtggctgccggggtgctctgtgag
ctggcccaagacaaggaggccgctgaggccatcgaggccgagggagccaccgctcccctg
acggagttactgcactcaaggaacgagggcgtggctacgtatgccgctgccgtgctgttc
cggatgtccgaggacaagccccaggactacaagaagcgtctttctgtcgagctgaccagc
tccctcttcaggaccgaaccaatgacttggaatgagactgctgatcttggacttgatatc
ggtgcccaaggagaaccccttggttatcgtccagatgatcctagctatcgttctttccac
tctggtggctatggtcaggatgccttgggtatggaccctatgatggaacatgaaatgggt
ggccaccacccaggtgctgattacccagttgatgggcttccagatctgggacatgcccag
gaccttatggatgggttgcctccaggtgacagtaatcagttggcttggttcgatactgac
ctgtaa

DBGET integrated database retrieval system