KEGG   Sarcophilus harrisii (Tasmanian devil): 100930707
Entry
100930707         CDS       T02286                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04066  HIF-1 signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04350  TGF-beta signaling pathway
shr04371  Apelin signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04714  Thermogenesis
shr04910  Insulin signaling pathway
shr04931  Insulin resistance
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05221  Acute myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100930707 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100930707 (RPS6KB1)
   04371 Apelin signaling pathway
    100930707 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100930707 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100930707 (RPS6KB1)
   04152 AMPK signaling pathway
    100930707 (RPS6KB1)
   04150 mTOR signaling pathway
    100930707 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100930707 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100930707 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100930707 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100930707 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100930707 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100930707 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100930707 (RPS6KB1)
   05205 Proteoglycans in cancer
    100930707 (RPS6KB1)
   05231 Choline metabolism in cancer
    100930707 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100930707 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100930707 (RPS6KB1)
   05212 Pancreatic cancer
    100930707 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100930707 (RPS6KB1)
   05226 Gastric cancer
    100930707 (RPS6KB1)
   05221 Acute myeloid leukemia
    100930707 (RPS6KB1)
   05224 Breast cancer
    100930707 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100930707 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100930707 (RPS6KB1)
   05165 Human papillomavirus infection
    100930707 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100930707 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100930707 (RPS6KB1)
   01522 Endocrine resistance
    100930707 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100930707 (RPS6KB1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100930707 (RPS6KB1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100930707 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100930707
NCBI-ProteinID: XP_003767963
Ensembl: ENSSHAG00000016073
LinkDB
Position
4
AA seq 525 aa
MRRRRRRDGFYPAPDFRDGEAEAMAGVFDIDLDQPEDAGSEDELEEGGQLSESMDHGGVG
PYEIGMEHCEKFEISETSVNKGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASAATTQTPVDYPMETSG
IEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcggcggcggcggcgggacggattttacccagcgccagacttcagagacggggaa
gctgaggccatggcaggagtttttgacatcgacctggaccagccggaagacgcaggctct
gaggatgagctggaggaagggggtcaattaagtgaaagcatggaccatgggggagttgga
ccatatgaaattggcatggaacattgtgaaaaatttgaaatctcagaaactagtgtgaac
aaagggccagaaaaaataagaccagaatgttttgagctacttcgagtacttggtaaagga
ggctatggaaaggttttccaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggctatgatagtaagaaatgcaaaagatacagctcataca
aaagcagaacgaaatatcctcgaagaagtaaagcaccccttcattgtggacttaatttat
gcctttcagactggtggaaaactctacctcatcctggagtatctcagtggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagatacagcttgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaagggatcatctacagagacctgaag
ccggaaaatatcatgcttaatcaccaaggtcatgtgaaattgacggactttggactatgc
aaagaatccattcatgatggaacagtcacacacacgttctgtggaacaatagaatacatg
gctcctgaaatcttgatgagaagtggtcataatcgtgccgtggactggtggagtttgggg
gcattaatgtatgacatgctgactggagcacctccatttactggggagaacagaaaaaag
acgattgacaaaatcctaaaatgtaaacttaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctaaaaagaaatgctgcttcacgtcttggagctggtcct
ggcgatgctggagaagttcaggctcatcctttcttcagacacattaactgggaagaactt
ctggctcggaaggtggagcccccttttaaacctcttttgcaatctgaagaggatgtgagc
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaaattttcatttgaaccaaaaatccgatcacctcgaagattcattggt
agccctcggacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagtgcagcaactactcagacacctgtggattatcccatggagacgagtgga
attgaacaaatggatgtgacggtgagtggagaggcatcagcaccacttccaatccgacag
cctaactctgggccatacaaaaaacaagcttttcctatgatttctaaacggccagaacac
ttgcgtatgaatctatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100935081
Entry
100935081         CDS       T02286                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04066  HIF-1 signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04350  TGF-beta signaling pathway
shr04371  Apelin signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04714  Thermogenesis
shr04910  Insulin signaling pathway
shr04931  Insulin resistance
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05221  Acute myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100935081 (RPS6KB2)
   04350 TGF-beta signaling pathway
    100935081 (RPS6KB2)
   04371 Apelin signaling pathway
    100935081 (RPS6KB2)
   04066 HIF-1 signaling pathway
    100935081 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    100935081 (RPS6KB2)
   04152 AMPK signaling pathway
    100935081 (RPS6KB2)
   04150 mTOR signaling pathway
    100935081 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100935081 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100935081 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100935081 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    100935081 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    100935081 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100935081 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100935081 (RPS6KB2)
   05205 Proteoglycans in cancer
    100935081 (RPS6KB2)
   05231 Choline metabolism in cancer
    100935081 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100935081 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100935081 (RPS6KB2)
   05212 Pancreatic cancer
    100935081 (RPS6KB2)
   05225 Hepatocellular carcinoma
    100935081 (RPS6KB2)
   05226 Gastric cancer
    100935081 (RPS6KB2)
   05221 Acute myeloid leukemia
    100935081 (RPS6KB2)
   05224 Breast cancer
    100935081 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100935081 (RPS6KB2)
   05163 Human cytomegalovirus infection
    100935081 (RPS6KB2)
   05165 Human papillomavirus infection
    100935081 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100935081 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100935081 (RPS6KB2)
   01522 Endocrine resistance
    100935081 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100935081 (RPS6KB2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100935081 (RPS6KB2)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100935081 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 100935081
NCBI-ProteinID: XP_012408527
Ensembl: ENSSHAG00000002574
UniProt: G3VIA5
LinkDB
Position
6
AA seq 473 aa
MAALFDIDLETEEGSEGDGEPELSPADLDPDLRTAACLEPMGHYEEVELSETCVNPGSEH
IGPHSFELLRVLGKGGYGKVFQVRKTQGTNMGKIFAMKVLRKAKIMRNAKDTAHTRAERS
ILEAVRHPFIVELIYAFQTSGKLYLILECLSGGELFMQLEREGIFMEDTACFYLGEITLA
LGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGSVTHTFCGTIEYMAPEIL
TRSGHNRAVDWWSLGSLMYDMLTGMPPFTAENRKKTIDKILRAKLALPAYLTPDARDLLK
KFLKRNPSQRLGGGPGDAADVQKHPFFRHINWQDLLALQVEPPFRPNLQSEEDVSQFDTR
FTKQTPVDSPDDSALGESASQVFLGFTYVAPSVLEGIKEGFSFQPKLRSPRRLNSSPRTP
ISPLKFSPFEAFRPSPGPPESMELPPPPVSSAPLPIRTPAGKKSKKGRGRSRR
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcggcgttgttcgatattgacctggagaccgaagaaggcagcgagggcgacggcgag
ccggagctcagccctgcggatttggacccggatttgaggacggctgcttgtttggagccc
atggggcactatgaagaggtggaattgtcagagacctgtgtgaaccctggatccgagcac
atcggcccccactcttttgagctcctccgagtcctgggcaaagggggctatggcaaggta
ttccaggtccggaagacacaaggcaccaacatggggaagatattcgccatgaaggtgttg
aggaaagcaaaaattatgcgcaacgctaaggacacggcccacacgcgggctgaacggagc
atcctggaggccgtgaggcaccccttcatcgtggagctgatctatgccttccagaccagt
ggcaagctctatctcatcctggaatgtctcagtggaggggagctcttcatgcagctggaa
cgggagggcatcttcatggaggacacagcctgtttctacttaggggagatcacgctggcc
ctgggccacctccactcccagggcatcatctacagggacctgaagcctgaaaacatcatg
ttgagcagccaaggtcacatcaagctgacggactttggcctgtgtaaagagtccatccat
gagggctccgtcactcacaccttctgcggcaccatagagtacatggcgcccgagatcctc
actcgcagtggccacaaccgggccgtggattggtggagcctgggatccctgatgtacgac
atgctcacaggaatgccgcccttcacggcagagaatcgcaagaagacgatcgacaagatc
ctgagggcgaagctggcgctgcccgcctacctcacgcccgatgctcgggacctgctcaag
aagtttttgaagagaaaccccagccagcgacttgggggcggacccggggatgcagcggat
gtccagaaacaccctttcttccgtcacatcaactggcaagatctcttggctctccaagta
gaacctcccttccggcccaacctgcagtcggaagaggacgtgagccagtttgacactcgc
ttcacgaagcagacgcccgtggacagccccgacgattctgcgctgggtgagagcgccagc
caggtcttcttgggcttcacctacgtggccccctcggtcctggagggcatcaaggaaggc
ttctcgttccagcccaaactgcggtcccctcggcgcctcaacagcagtccccgcaccccc
atcagccccttgaaattctcgccttttgaagcattccgacccagccccggccccccggag
tccatggaactacccccacccccggtcagttcagccccgcttcccatccggactcccgcc
ggcaagaagtccaagaagggccggggccgttccaggcgctag

DBGET integrated database retrieval system