Sarcophilus harrisii (Tasmanian devil): 100931317 Help Entry 100931317         CDS       T02286                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04010   MAPK signaling pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04020   Calcium signaling pathway shr04151   PI3K-Akt signaling pathway shr04714   Thermogenesis shr04810   Regulation of actin cytoskeleton shr05200   Pathways in cancer shr05218   Melanoma shr05224   Breast cancer shr05226   Gastric cancer Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100931317 (FGF21)    04014 Ras signaling pathway     100931317 (FGF21)    04015 Rap1 signaling pathway     100931317 (FGF21)    04020 Calcium signaling pathway     100931317 (FGF21)    04151 PI3K-Akt signaling pathway     100931317 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100931317 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     100931317 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100931317 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     100931317 (FGF21)    05218 Melanoma     100931317 (FGF21)    05224 Breast cancer     100931317 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100931317 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100931317 (FGF21) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Growth factors (RTK binding)    100931317 (FGF21) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Growth factors/receptors    100931317 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100931317 NCBI-ProteinID:  XP_031819304 LinkDB All DBs Position 3:complement(600950425..600953043) Genome browser AA seq 202 aa AA seqDB search MGLRERAPRYLAPLLSLLLACRASGHPLPDSSPMLLFGGQVRLRHLYTDVGQEAEAHVEL ASDGTVRAAARRSPNSLLELKAVKPGIVRILAVHSSRFLCMRPNGELYGAIHYDPSACNF RERLLGDGYNVYESEAHGRTLRLPPKAAPGPAGPSRFLPLPGDRLPGPEPPWPQGPELPD VGSADPLSMVGGSQGRSPSFSS NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgggcctgagggagcgagctcccaggtacctggccccgctgctgtccttgctcttggcc tgcagggcctcgggtcaccccctcccggattccagccccatgctcctgtttggggggcag gtccgcctccggcacctctacacggatgtgggccaggaggccgaggcccacgtggaactg gcgtccgacggcacagtccgggcggcagcgcggaggagtcccaacagtctcctggagctg aaggctgtgaagccgggcatcgtccgaatcctggccgtccacagctctcggtttctgtgt atgaggcccaacggggagctgtacggagcgatacactacgacccttccgcctgcaacttt cgggagcgcctgctgggggacggctacaacgtgtacgagtccgaggctcacgggaggacc ctccgcctgccccccaaggccgccccgggacccgccggaccttctcgcttcctgccgctc cccggcgatcggctgcccggccccgagccaccctggccacagggtcccgagctcccggac gtgggctcggcggacccattgagcatggtggggggctcgcagggccggagccccagcttc tcctcctga

DBGET integrated database retrieval system