KEGG   Sarcophilus harrisii (Tasmanian devil): 100933866
Entry
100933866         CDS       T02286                                 

Gene name
CUL4B
Definition
(RefSeq) cullin-4B isoform X2
  KO
K10609  cullin 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03420  Nucleotide excision repair
shr04120  Ubiquitin mediated proteolysis
shr05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100933866 (CUL4B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100933866 (CUL4B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100933866 (CUL4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100933866 (CUL4B)
   03400 DNA repair and recombination proteins [BR:shr03400]
    100933866 (CUL4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100933866 (CUL4B)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     100933866 (CUL4B)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100933866 (CUL4B)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100933866 (CUL4B)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100933866 (CUL4B)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW HbrB
Other DBs
NCBI-GeneID: 100933866
NCBI-ProteinID: XP_003774810
Ensembl: ENSSHAG00000011426
LinkDB
Position
X
AA seq 902 aa
MKSVCPVAAGFSSPNPSAAAAAPPSQEVRSATDGHNSTSPTSTTSSSCSKKRKLNTSGSN
EKEDFDPIPSSCSSSPPPPPKNSSTSSSASSTASCPGISIAAPNHHHLQKKLRFEDSLDF
LGLDVKMAEESASSSSPGLGVSQQQLKNKSLLISSVATGHHANGLTKAPSSISSFTNSKP
GSAKKLVIKNFKEKPKLPENYTDETWQKLKDAVEAIQNSTSIKYNLEELYQAVENLCSYK
ISANLYKQLRQICEEHIKSQIHQFREDSLDSVLFLKKIDKCWQNHCRQMIMIRSIFLFLD
RTYVLQNSMLPSIWDMGLELFRTHIISDQKVQNKTIEGILLLIERERSGEAIDRSLLRSL
LSMLSDLQIYQDSFEQKFLEETNRLYSAEGQRLMQEREVPEYLHHVNKRLEEEADRLITY
LDLSTQKPLIATVEKQLLGEHLTAILQKGLNHLLDENRIQDLSLLYQLFSRVRSGVQVLL
QHWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDVCFMKNEKFVNAMKEAFETF
INKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDL
AKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVQFKQYIQNQNF
PGNIELTVNILTMGYWPTYVPMEVHLPAEMVRLQEIFKTFYLGKHSGRKLQWQSTLGHCV
LKAEFKEGRKELQVSLFQTLVLLMFNEGEEFSLEDIKQATGIEDGELRRTLQSLACGKAR
VLTKNPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQID
AAIVRIMKMRKALGHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNY
IA
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgaaaagtgtttgccctgtcgctgccggtttctcatcccccaacccctcagctgctgct
gctgctcctccttcccaggaggtcagatctgccactgatggtcataacagcactagccct
acttcgaccacctcctcctcctgttccaagaagagaaagttaaacaccagtggcagcaac
gagaaagaagactttgatcccatcccctcttcctgctcctcctctcccccgccccctccc
aagaactcctctacatcctcttctgcctcttctaccgcctcctgccctgggatttcaatt
gctgccccgaaccatcaccacctccagaagaaactgcgttttgaagactccttggatttt
ttaggacttgatgtgaagatggccgaggaatcggcgtcttcgtcttcacctggtcttggt
gtatctcagcagcaacttaaaaacaaaagcttattaatctcctctgtggctacagggcac
catgcaaatgggctaaccaaagcccccagttccatctctagcttcaccaacagcaaacca
ggatcagcgaagaaattggtgatcaagaactttaaagaaaaacccaaactgccagagaac
tatacggatgaaacatggcagaaactgaaagatgcggtagaagccattcaaaatagtact
tcaattaaatacaatctagaagaactttatcaggctgtggaaaacctctgttcttataag
atatctgcaaacttatacaaacagctgagacagatttgtgaagagcacatcaaatcccag
attcaccaattccgagaggattctttggacagtgttctgtttctaaagaagatagataaa
tgctggcaaaatcactgcagacaaatgatcatgatcaggagcatttttttgtttttggat
agaacctatgttcttcagaattcaatgctgccttcaatttgggacatgggtttagaactg
tttaggacccatataattagtgatcagaaagtccagaacaagactattgaaggcattctc
cttttgattgagagagaaagaagtggtgaagcaattgatagaagtttgcttcgaagcctc
ctgagtatgctttcagatctacagatctatcaagattcttttgaacagaaatttttggaa
gaaaccaaccgtttgtattctgcagagggtcagcgtttaatgcaagaaagagaggttcct
gaataccttcatcatgtcaacaagcgtctggaagaagaagcagacagactgatcacctat
ctggatctgagcacccagaagccactaattgctactgtagaaaagcaacttctaggtgaa
cacttaacagccattcttcagaaaggtttaaatcatcttctggacgaaaatcgtattcaa
gatttgtctctgctctatcaactatttagtagagtacgcagtggagttcaggttctttta
cagcactggatcgaatacatcaaggcatttggcagcactattgtcattaatcctgaaaaa
gataagaccatggtacaagaattgttggattttaaagataaagttgatcacatcattgat
gtctgctttatgaaaaatgaaaagtttgtcaatgctatgaaagaagcatttgaaaccttc
attaacaagagaccaaacaagcctgctgaactcatagcaaaatacgtggattcaaaactc
cgtgcaggaaataaagaagctacagatgaagaacttgagaaaatgttggataagatcatg
attatatttcgcttcatttatgggaaagatgtctttgaagccttttataagaaggattta
gccaagagactgttggtgggaaagagtgcatctgtagatgctgagaagtcgatgctttcc
aaactcaagcatgaatgtggagctgctttcaccagcaaactggaaggaatgttcaaagac
atggaactgtccaaagacatcatggttcagttcaaacagtatatacaaaaccagaatttt
cctgggaacattgaactaactgtgaatatcttaacaatgggttattggccaacctatgtg
cctatggaggttcacttaccggctgagatggtaagacttcaggagattttcaagactttt
tacttgggtaaacatagtgggaggaaacttcagtggcagtcaacacttggacattgtgta
ctaaaagcagaatttaaagaggggagaaaagaactccaggtatctctcttccaaaccctg
gtgctactgatgtttaacgaaggtgaagaattcagtttggaagacatcaagcaagctaca
ggaatagaggatggagaattaagaagaacacttcagtcattggcttgtggcaaagccaga
gttctgactaaaaatccaaagggcaaagatgtggaagatggtgataaatttacctgcaat
gatgacttcagacacaaactctttcggataaaaatcaatcagatccagatgaaagaaacg
gtagaggaacaagcaagcactacagaaagggtctttcaggatcgacaatatcagattgat
gctgcaattgtgagaatcatgaagatgagaaaggcccttggccacaacctgctggtttct
gaagtgtataaccaattgaagtttcccgtaaagcctgccgatctcaagaagagaatagaa
tccttaatcgacagggactacatggaaagagacaaagaaaacccaaaccagtacaactat
attgcctaa

DBGET integrated database retrieval system