KEGG   Sarcophilus harrisii (Tasmanian devil): 100934452
Entry
100934452         CDS       T02286                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04072  Phospholipase D signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04640  Hematopoietic cell lineage
shr04916  Melanogenesis
shr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100934452 (KITLG)
   04014 Ras signaling pathway
    100934452 (KITLG)
   04015 Rap1 signaling pathway
    100934452 (KITLG)
   04072 Phospholipase D signaling pathway
    100934452 (KITLG)
   04151 PI3K-Akt signaling pathway
    100934452 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100934452 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100934452 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934452 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100934452 (KITLG)
Cytokines and growth factors [BR:shr04052]
 Growth factors
  Growth factors (RTK binding)
   100934452 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100934452
NCBI-ProteinID: XP_023360103
Ensembl: ENSSHAG00000006147
LinkDB
Position
5
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICGNPVTDDVKEITTLVANLPNDYMINLKYVPG
MELLPNHCWLHLMVPELATSLNNLLYRFSKISSSLSNYSIIDKLIKIIDDLMGCLEEKNK
NFRKQNNNIYKEGSFIPEKFFSFFNKSINAFKELEEIPERSNCVLPSTIRPEKDFRVNVT
KPFLLPPVAASSLRNDSSSSNRKSSGPDKNSSVHWVAIVLPSFFSLVIGFVLGVLYWKKK
QMSLKMEGDNREINEEDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcagctgctcctattcaat
cctctcgtcaaaactaaagggatctgtgggaatcctgtgaccgatgatgtgaaagagatt
acaacattggtggcaaatcttccgaatgactatatgataaatcttaagtatgtccctggg
atggaactcttgcctaatcactgttggttacatctgatggttcctgaattggccaccagc
ctgaataacctcttatacagattttccaaaatttccagtagtctgagtaattattcaatc
attgataaactcataaaaatcattgatgacctgatgggatgcttagaagagaaaaataag
aatttcagaaaacaaaataacaacatttataaagaaggctcgttcattcccgaaaaattt
tttagcttctttaataaatccatcaatgccttcaaggaacttgaagaaatacctgagcgt
agcaactgtgtcctgccttcaacaataaggcctgagaaagatttcagggtcaatgtcaca
aaaccatttttgttaccccccgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaagtcatcaggacctgataaaaactcaagtgtgcattgggtagccattgtgttg
ccgtcattcttttctcttgtaattggctttgttctgggagttttatactggaagaaaaaa
caaatgagtcttaaaatggaaggtgacaacagagagattaatgaagaggataatgagatt
agtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system