KEGG   Sarcophilus harrisii (Tasmanian devil): 100934801
Entry
100934801         CDS       T02286                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04150  mTOR signaling pathway
shr04270  Vascular smooth muscle contraction
shr04510  Focal adhesion
shr04650  Natural killer cell mediated cytotoxicity
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing syndrome
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100934801 (BRAF)
   04012 ErbB signaling pathway
    100934801 (BRAF)
   04015 Rap1 signaling pathway
    100934801 (BRAF)
   04068 FoxO signaling pathway
    100934801 (BRAF)
   04024 cAMP signaling pathway
    100934801 (BRAF)
   04150 mTOR signaling pathway
    100934801 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100934801 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100934801 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100934801 (BRAF)
   04062 Chemokine signaling pathway
    100934801 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100934801 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100934801 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100934801 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100934801 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100934801 (BRAF)
   04720 Long-term potentiation
    100934801 (BRAF)
   04730 Long-term depression
    100934801 (BRAF)
   04722 Neurotrophin signaling pathway
    100934801 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934801 (BRAF)
   05205 Proteoglycans in cancer
    100934801 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100934801 (BRAF)
   05212 Pancreatic cancer
    100934801 (BRAF)
   05225 Hepatocellular carcinoma
    100934801 (BRAF)
   05226 Gastric cancer
    100934801 (BRAF)
   05214 Glioma
    100934801 (BRAF)
   05216 Thyroid cancer
    100934801 (BRAF)
   05221 Acute myeloid leukemia
    100934801 (BRAF)
   05220 Chronic myeloid leukemia
    100934801 (BRAF)
   05218 Melanoma
    100934801 (BRAF)
   05211 Renal cell carcinoma
    100934801 (BRAF)
   05219 Bladder cancer
    100934801 (BRAF)
   05215 Prostate cancer
    100934801 (BRAF)
   05213 Endometrial cancer
    100934801 (BRAF)
   05224 Breast cancer
    100934801 (BRAF)
   05223 Non-small cell lung cancer
    100934801 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100934801 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100934801 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100934801 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100934801 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100934801 (BRAF)
   05160 Hepatitis C
    100934801 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100934801 (BRAF)
   01522 Endocrine resistance
    100934801 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100934801 (BRAF)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100934801 (BRAF)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100934801 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100934801
NCBI-ProteinID: XP_031795065
Ensembl: ENSSHAG00000016011
LinkDB
Position
5
AA seq 806 aa
MAALSGGGGGGGGGGAEQGPALFNGDMDPETGAGSASSAEPAIPEEVWNIKQMIKLTQEH
IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVSSSASTDTV
TSSSSSSLSVAPSSLAVFQNPTDMSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRRQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK
TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI
PQEEASLGETTLTSGSSPSAPPSDSIGPPLLTPSPSKSIPIPQPFRPADEDHRNQFGQRD
RSSSAPNVHINTIEPVNIDDLIRDQGLRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEI
VFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTL
GRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE
VGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTA
QGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMA
PEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKV
RSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTE
DFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcggcggcggcggcgcggagcagggcccc
gctctgttcaacggggacatggatcccgagactggcgccggctcggcatcctccgccgag
ccggccatccccgaggaggtatggaatatcaagcaaatgataaaattgacacaggaacac
atagaagccctattggacaaatttggaggagaacataacccaccatcaatctatctcgag
gcctatgaagaatacaccagcaagctagatgcacttcaacaacgggaacaacaattatta
gagtccatggggaatggaactgatttttctgtttctagctcagcttcaacagacacagtt
acatcttcttcctcttctagcctgtcagtggcaccttcatctcttgcagtttttcagaat
cccacagacatgtcaagaagcaatcccaagtcaccacaaaaaccaattgttagagtcttc
ctgcccaacaaacagaggactgtggtaccagcaagatgtggagtaactgtccgagatagt
ctaaagaaggcattgatgatgagaggcttgatcccagaatgctgtgcagtgtacagaaga
caggatggagagaagaagcctattggctgggacactgatatttcctggcttactggagaa
gaactgcatgtagaagttttggagaatgttcccctaacaacacacaattttgtacggaag
acatttttcactttagcattctgtgacttttgtcgaaagctgcttttccaaggtttccgc
tgtcagacatgtggttataaatttcaccaacgctgtagtacagaggtgccactgatgtgt
gttaattatgaccaacttgatttgctgtttgtctccaagttctttgaacatcacccaata
ccgcaggaggaggcctccttaggagagaccacccttacgtcgggatcatccccttcagca
cccccctcagattccattgggcccccacttcttactccatcgccttcaaaatccattcca
atcccacagccctttcgaccagcagatgaggatcatcggaaccagtttgggcaacgtgac
aggtcctcatcagctcccaatgtgcatataaacacaatagagcctgtcaatattgatgac
ttgattagagaccaagggttacggggtgatggagcccccttgaaccaactgatgcgctgt
cttcggaaataccaatcccggactcccagtcccctcctacattctgtccccagtgaaata
gtgtttgattttgagcctggcccagtgttcagaggatctactacagggttgtctgccact
cctcctgcttccttgcctggatctctaactaatgtgaaagcattacaaaaatctccagga
cctcagcgtgaaagaaaatcttcatcatcttctgaagacaggaatagaatgaaaaccctt
ggtcgacgagactcaagtgatgattgggaaattccagatgggcagattacagttggacaa
aggataggatctggatcatttggaacagtctataaggggaaatggcatggtgatgtagct
gtgaaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaa
gtaggagtgctcaggaaaacacgacatgtgaatatcctactctttatgggctattcaaca
aaaccacagttggccattgttacacagtggtgtgaaggctccagtttatatcaccatcta
catatcattgagaccaaatttgagatgatcaagctaatagatattgcacggcaaacagca
caaggcatggattatttacatgccaagtccatcatccatagagacctcaagagtaataat
atatttcttcatgaagacctcacagtaaaaataggagattttggtctggctacagtaaag
tcacgatggagtggttcccatcagtttgaacagttatctggatccatcttgtggatggca
ccagaggtcattagaatgcaagataaaaacccatatagttttcaatcagatgtatatgca
tttgggattgttctgtatgagttgatgacaggacagttaccttactcaaacatcaacaac
agggaccagataatttttatggtggggcgaggatacttgtcgccagatcttagtaaggtg
cggagtaattgtccaaaagccatgaagaggttaatggcagagtgcctgaagaagaagaga
gatgagaggccactttttccccagattcttgcctccattgaacttctggcccgctcattg
ccaaaaattcaccgcagtgcatctgaaccctcattgaatcgggctggcttccaaacggag
gattttagtctgtatgcttgtgcttctccaaaaacacccatccaggcagggggatatgga
gaatttgccgccttcaagtag

DBGET integrated database retrieval system