KEGG   Shewanella sp. W3-18-1: Sputw3181_2338Help
Entry
Sputw3181_2338    CDS       T00453                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shw  Shewanella sp. W3-18-1
Brite
Enzymes [BR:shw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sputw3181_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABM25162
LinkDB All DBs
Position
2692695..2693279
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFADKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFEAFKAQFTDSAVNNFG
SAWTWLVKKADGTLAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNYAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacttatgttgttaagctaaac
ggcttaatcgaaggaactgatttcgcagacaaatctttagaagaaatcatcaaaacctct
actggtggtgtgtttaacaacgcagctcaagtgtggaaccacactttctactggaactgc
ctagcgccaaatgctggcggcgagccaactggcccagttgctgatgccatcaatgcagcc
ttcggttcatttgaagcatttaaagcacaatttactgattcagcagtgaataacttcggt
agcgcttggacttggttagtaaaaaaagccgatggtactcttgctatcgttaacactagc
aacgctgcaacaccactgactgacagcactgtgacaccaatcctgactgtagatgtgtgg
gaacacgcttactacatcgattaccgcaacgtacgtccagactatttagcccacttctgg
caattagtaaactgggacttcgtgaaccaaaactacgcgggttaa

DBGET integrated database retrieval system