KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5522Help
Entry
SHJG_5522         CDS       T02063                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00250  Alanine, aspartate and glutamate metabolism
shy00410  beta-Alanine metabolism
shy00430  Taurine and hypotaurine metabolism
shy00650  Butanoate metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy02024  Quorum sensing
Module
shy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SHJG_5522
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJG_5522
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJG_5522
   00430 Taurine and hypotaurine metabolism
    SHJG_5522
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SHJG_5522
Enzymes [BR:shy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SHJG_5522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEY90789
UniProt: H2JM56
LinkDB All DBs
Position
complement(6309620..6311026)
Genome map
AA seq 468 aa AA seqDB search
MALHRGPDKHEERTMSVNPFFGEANPVGGMTEAPPTHRLPDAALPPSTAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMDECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
SAAVGCSTTGSSEACMLAGMALKRRWAKRNADRYPGARPNLVMGVNVQVCWEKFCTFWEV
EARTVPMEGDRFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVADLCAALDALQERTG
LDIPVHVDGASGGMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDKEAL
PEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQSTRDVATSLAS
RIEALGDFRLLTRGDQLPVFALTTADHVTSYDVFDVSRRLREGGWLVPAYTFPANREDLS
VLRIVCRNGFSHDLADLFLDDLARLLPELRRQPHPLTRDKEAATGFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcacagaggtcccgacaagcacgaggagcggacgatgtcggtcaacccgttc
ttcggggaggccaaccccgtcggcggcatgaccgaggcaccgcccacgcaccggctcccg
gacgccgcgctgccgccgtccacggcgtaccagctggtgcacgacgagctgatgctggac
ggcaactcccggctcaatctggccaccttcgtcaccacctggatggaaccgcaggccggg
gtgctgatggacgagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacg
gccgagctggagcggcgctgcgtggcgatgctcgcggacctgtggaacgcgccggacccg
tcggcggccgtcggctgttcgacgaccgggtcgagcgaggcctgcatgctcgccgggatg
gcgctgaagcggcgctgggcgaagcggaacgccgaccgctatccgggcgcgcggcccaat
ctggtcatgggcgtcaacgtccaggtgtgctgggagaagttctgcaccttctgggaggtg
gaggcccggacggtcccgatggagggcgaccgcttccatctggacccgcaggccgccgcc
gagctgtgcgacgagaacaccatcggggtcgtcggcatcctcggctcgaccttcgacggc
tcctacgagccggtcgccgacctgtgcgcggccctggacgccctccaggagcggaccggg
ctcgacatcccggtgcacgtggacggcgcgtccggcgggatggtggcgcccttcctggac
gaggacctggtgtgggacttccgcctgccgcgcgtggcgtcgatcaacacctccgggcac
aagtacgggctggtgtatcccggcgtcggctgggcgctgtggcgggacaaggaggcgctg
cctgaggagctggtcttccgggtgaactacctgggcggcgacatgccgaccttcgcgctg
aacttctcccggcccggtgcccaggtggtggcgcagtactacacgttcctgcggctgggc
cgggagggttaccgggcggtgcagcagtcgacgcgggacgtggcgacctcgctcgcctcc
cggatcgaggcgctcggcgacttccggctgctcacgcgcggggaccagctccccgtgttc
gcgctgaccaccgccgaccacgtcacctcgtacgacgtcttcgacgtctcccggcggctg
cgcgagggcggctggctcgtgcccgcctacaccttcccggcgaaccgtgaggacctgtcc
gtgctgcggatcgtgtgccgcaacggcttctcgcacgacctggccgacctgttcctggac
gacctggcccgcctgctgccggagctgcgccgccagccgcaccccctgacccgcgacaag
gaggcggccaccggcttccaccactag

DBGET integrated database retrieval system