Sphingobium xenophagum: CJD35_18760 Help Entry CJD35_18760       CDS       T05146                                  Name (GenBank) hypothetical protein   KO K04078   chaperonin GroES Organism shyd  Sphingobium xenophagum Brite KEGG Orthology (KO) [BR:shyd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:shyd03110]     CJD35_18760    03029 Mitochondrial biogenesis [BR:shyd03029]     CJD35_18760 Chaperones and folding catalysts [BR:shyd03110]  Heat shock proteins   HSP10    CJD35_18760 Mitochondrial biogenesis [BR:shyd03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     CJD35_18760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  ASY46531 UniProt:  A0A249MYS9 LinkDB All DBs Position p1:143212..143412 Genome browser AA seq 66 aa AA seqDB search MSFAVGPGTRDENGKLTDTTVKTGDRVLFGKWSGSEVRIDGEDLLIMKESDILGIIEPVA ELKQAA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt ttgagcttcgcggtcggccctggcactcgcgacgaaaacggaaagctcaccgacaccacg gtgaagaccggcgaccgggtgctgttcggcaaatggtcgggcagcgaggttcgcatcgat ggcgaggatctgctcatcatgaaggagagcgacatcctcggcatcatcgagcccgtcgcg gagctcaagcaggccgcctga

DBGET integrated database retrieval system