KEGG   Streptococcus intermedius B196: SIR_0015Help
Entry
SIR_0015          CDS       T02830                                 

Gene name
nanA
Definition
(GenBank) neuraminidase A protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sib  Streptococcus intermedius B196
Pathway
sib00511  Other glycan degradation
sib00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sib00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SIR_0015 (nanA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SIR_0015 (nanA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sib02042]
    SIR_0015 (nanA)
Enzymes [BR:sib01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SIR_0015 (nanA)
Bacterial toxins [BR:sib02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SIR_0015 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 BNR_3 BNR DUF4185 Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: AGU75433
UniProt: T1ZC06
LinkDB All DBs
Position
15910..18672
Genome map
AA seq 920 aa AA seqDB search
MNWSFFNWKKQDKIRKLVVGATFIVIGIAIFLALSGLKQVNTVLANTKKVESGINNSIAD
LLKETNVIPRDYYARQLENVQTIFEKENVVTNDSNNQRIDLSGELDKLKQLQTATIHIEF
KADANAPRFYNLFSVSSDKVKNEYFTMAVYNNTAIVEGRDKDGKQFYNSYNDAPLKIKSG
QWNSVTFTVDGPNSDHPNGQVRLYVNGVLSRTSKLSGRFIKDMPDVNHVQIGKTNRARSM
MWGSNLHVRNLTVYNRALTSEEVQKRSQLFKRSDLEKRLPEGALLTEKTDVFKSGYNNQP
NSEGINSYRIPALLRTDKGTLIAGADQRRLHHADYGDIGMVVRRSEDNGKTWGDKKVLSN
LRDNPDAKDPVAPSPLNIDMTLVQDPTTKRIFAIYDMFPEGKGIFGMPKNNEKAYEQVGD
KTYQILYKQGEFGHYTIRENGEVYDANNQKTDYRVVVNPTKADYRDKGDIYKGQELVGNI
YFAQSKKNPFRIAYTSYLWMSYSDDDGKTWSAPRDITSGVRKDWMKFLGTGPGTGIVLRT
GKHKGRILIPVYTTNNVSHLNGSQSSRLIYSDDHGETWHAGEAVNDNRQVGGQKIHSSTM
NNRNAQNTESTVVQLNNGDIKLFMRGLTGDLQVATSKDGGATWEKEIKRYPQVKDVYVQM
SAIHTMHDGIEYVVLSNAGGPERTNGLVHLARVEKNGELTWLKHNLIQKGEFAYNSLQDL
GNGEYGLFYEHRENGQNPYTLSYKKFNWDFLSKDLISPKEVKVKKAVDRGKGVVGLEFDS
EVLVNQAPTLELTNGKIATFITQYDSKTLLFKVDKGAIGQKITGLASGSIESIHNLPVNL
TGASIPGGVNGGEGTVNEVPEYKEKKSTKKPATEKKQANKVLTNHHNLPSTGSTTNVPVL
FLGIATIILGLLTMINKRKQ
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaattggtcttttttcaattggaaaaaacaagataaaattcgtaaattagtggttggg
gcaactttcatagtaataggaatagctatttttttagctttgtcaggcttgaaacaggta
aatacagtgcttgcgaatactaaaaaagttgaatcagggataaataattctatagcagat
ttgctaaaagaaactaatgttattccacgtgattactatgctagacaattggaaaatgtt
cagacgatctttgaaaaagagaatgttgtaacaaatgattcaaataatcagagaattgac
ctttcaggggaattagataaattaaaacagcttcaaactgcaacaattcatatagaattt
aaagcagatgctaatgcgccacgattttataatcttttttccgtatctagtgataaggtt
aagaatgaatattttacaatggcagtttacaataatactgctatcgtagagggtcgagat
aaagatggaaaacaattctacaatagttataatgatgcacccttaaaaattaaatcaggc
cagtggaattctgtcacttttacagttgatggaccaaattcggatcatccaaatggacaa
gttaggctctatgtcaatggtgttctgtctcgaacaagtaaattatcaggacgttttatc
aaagatatgccagatgttaatcatgttcagattggtaagactaatagagcgagaagtatg
atgtggggttccaacttgcacgttagaaatctcacggtttataatcgtgctttgacgtca
gaggaagttcaaaaacgtagtcaactttttaagcgatcagatcttgagaaaaggctaccc
gagggagctcttttaactgaaaagacagatgtctttaaaagcggatataacaatcaaccc
aatagtgaaggcatcaatagttatcgtattcctgcccttctcagaacggataaaggcact
ttgatagctggtgctgatcaaagacggttacaccacgctgactatggcgatattggtatg
gtagtgcgtcgtagtgaggataatggaaaaacttggggggataagaaggtcttgtccaat
ctaagggacaatcctgatgcaaaggatcctgttgcaccatctcctctcaatattgacatg
actctagttcaagatccaacgacgaagagaatcttcgcaatttatgatatgttcccagag
gggaagggaatttttggaatgcctaaaaataatgaaaaagcttatgaacaggtaggggat
aagacttatcaaatcttgtataaacaaggagaatttgggcattacactattcgtgagaat
ggcgaagtttatgatgctaataatcagaaaacagactatcgtgttgtagtcaatcctaca
aaagcagattatagagataaaggagatatttacaaaggtcaggaattggttggaaatatt
tattttgcccagagtaagaaaaatccatttagaatagcttatacaagttatctgtggatg
tcctacagtgatgatgatggaaaaacgtggtctgcaccaagagatattacatcaggggtt
cgtaaggactggatgaaattccttggaacaggtcctggaacaggcattgtgctgcgtaca
ggaaagcacaaggggcgtatcttgataccagtttatacaaccaataacgtatcacatttg
aatggttctcaatcttctcgtttgatttattcagatgaccatggagaaacttggcatgct
ggcgaagcagttaatgacaatcggcaagtaggaggtcagaagatacattcttctaccatg
aataataggaatgctcaaaatacagaatcaacagttgttcaactgaataatggagatatc
aaactctttatgcgtggcctaacaggagatcttcaggttgctacaagtaaagatggtggt
gcaacttgggaaaaggaaattaaacgctatcctcaggttaaagatgtctatgttcaaatg
tctgccattcataccatgcatgatggtatagaatatgttgtcctcagtaatgcaggtgga
ccagaacgtacgaatggcttggtgcacttggcgcgtgttgagaaaaatggtgagttgact
tggttgaaacacaatttgattcaaaaaggagaattcgcttataactctcttcaagaccta
ggaaacggagagtatggattattttatgaacatcgtgagaatgggcaaaatccctatact
ttatcttataagaaatttaactgggattttttgagtaaagatttaatttctcctaaagaa
gtcaaagtgaaaaaagctgtggataggggaaaaggagttgttggcttggagtttgattca
gaagttttagtcaatcaggcaccaactctcgaattgactaatgggaaaatagcaactttc
ataacccagtacgacagcaaaactttgctatttaaggttgataagggagctattggtcaa
aaaatcactggtttagcatcaggaagtattgaaagtatacacaacctccctgtgaatctg
acaggtgctagcattcctggaggagtaaacggcggtgaaggaactgtaaatgaagtacca
gaatacaaagagaaaaaatctactaaaaaacctgccacagagaaaaagcaggctaataaa
gtcttgacaaatcatcataaccttccatctacaggtagcacaactaatgtgccagtactg
tttttaggtattgcaacgataatcttaggattgttgacaatgataaataaaagaaaacag
taa

DBGET integrated database retrieval system