KEGG   Sulfolobus islandicus M.16.4: M164_0762
Entry
M164_0762         CDS       T00906                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sid  Sulfolobus islandicus M.16.4
SSDB
Motif
Pfam: GATase_4 GATase_6
Other DBs
NCBI-ProteinID: ACR41380
UniProt: C4KFG4
LinkDB
Position
complement(714003..714689)
AA seq 228 aa
MCRMLAYHGDDKEYLKRLTNCLAKASLNDPLTNETHGDGWGIVAIASNNLIHYRSHLPIF
KDENLEKILNLLDGEMKVIIHARQASDKRLISPYYSHPYLESTPKSILFLAHNGSVDKYK
LGNVLGIDPMLMVDSELVAKYFATYSIKEIDKLQDVTQSALNLLIMEINRIDRSSTIYFY
NYYRKDKIKRKEEYYKLYFNKGAIYSSSLAYTGCEKGEEVKFGNLGEL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtgtagaatgttagcataccatggagatgataaggagtacttaaagagacttacgaat
tgcctagctaaggcatcactaaatgacccattaaccaatgaaacccatggggatggctgg
ggaattgtggcaattgctagtaataatttaatacattacagaagccatctcccaatattt
aaggacgaaaatctagagaaaatcctaaacttgctagatggtgaaatgaaagtaataatt
cacgctaggcaagccagtgataagagattaatctccccctattattcccatccttattta
gaaagtactccaaaatcaatactattcttagcccataatggtagtgtcgataaatacaaa
ttgggtaatgtactaggaatagaccccatgctaatggtagactcagaacttgttgccaaa
tattttgcaacatacagcattaaagagattgacaagttgcaggacgttacacaatccgca
ttaaatctactaatcatggagataaataggattgatagatcctctactatctacttctat
aactattatagaaaggataagataaaaagaaaggaagagtactataagttatattttaat
aaaggtgctatctactcttcatctttagcctatactggttgtgaaaaaggtgaggaggtt
aagttcgggaatctgggagagctataa

DBGET integrated database retrieval system