KEGG   Streptococcus intermedius JTH08: SCIM_0725Help
Entry
SCIM_0725         CDS       T02156                                 

Gene name
nagD
Definition
(GenBank) N-acetyl-glucosamine matabolism protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sie00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCIM_0725 (nagD)
Enzymes [BR:sie01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SCIM_0725 (nagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: BAM23379
LinkDB All DBs
Position
844876..845649
Genome map
AA seq 257 aa AA seqDB search
MTYKGYLIDLDGTIYKGKERIPAGEAFVRELQRRKIPYLFVTNNTTRTPETVKTMLDENF
NIETPLETIYTATLATIDYMQEKNLGKKAYVIGDVGLKHAIEEVGYIEDTENPDYVVVGL
DWEVDYEKLSIATLAIQKGAHFIGTNPDLNIPTERGLQPGAGAINALLEAATRVEPTFIG
KPNAIIMEKAVEHLGLPREEVIMVGDNYLTDIRAGIDNGIPTLLVTTGFTRPEEVASLPI
QPDYVLSSLAEWDFDAH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgacttataaaggctatttaattgatttagacggaacaatttataaaggaaaagaacgt
attcctgctggtgaagcttttgtacgtgagttgcaacggcgcaagattccctatcttttt
gtgaccaataataccacgcgcacgccagaaaccgtcaagaccatgctggatgaaaatttc
aatattgagaccccacttgagactatttacacagctactttagctaccattgactatatg
caggaaaaaaatctaggcaagaaagcttatgtcatcggagatgtcgggcttaaacatgct
attgaagaagttggatatatagaggacacagaaaatcctgactatgtggtagtggggttg
gattgggaagtagattatgaaaaattgtcgattgctactttagccattcaaaagggtgct
cactttatcgggactaatcctgatctcaatattccgacagagcgtggtctgcagccggga
gcgggtgctattaatgccctcttggaagcagccactcgggttgagccgacctttatcggc
aagcccaatgccatcattatggaaaaagctgttgaacaccttgggttgccacgtgaagag
gtaattatggttggtgataactatcttacggatattcgagctgggattgataatggcatc
cctacacttttggtgacaactggatttactcgtccagaggaagtagcgagcttaccaatc
caaccagattatgtgctttctagtttagcggagtgggattttgatgcacactaa

DBGET integrated database retrieval system