KEGG   Simplicispira sp. SC1-8: C6571_08020Help
Entry
C6571_08020       CDS       T05361                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
simp  Simplicispira sp. SC1-8
Pathway
simp00500  Starch and sucrose metabolism
simp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:simp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C6571_08020 (treS)
Enzymes [BR:simp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     C6571_08020 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     C6571_08020 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AVO41241
LinkDB All DBs
Position
1717363..1720683
Genome map
AA seq 1106 aa AA seqDB search
MNAPMPVLALETVEIDTSGDPTWYRDAVVYQLNVKAFSDSNSDGVGDFKGVTSKLDYVQD
LGVNTIWLMPFYPSPLRDDGYDISEYEDVHPQYGTLADFREMLEEAHKRGLRVITELVIN
HTSDQHPWFQAARNAPPGSPERDFYVWSDTDQLYQGTRIIFTDTEKSNWTWDPVAKQYFW
HRFFSHQPDLNFDNPQVLEAVYRTMRFWLDMGVDGFRLDAIPYLIERDGTSNENLPETHE
VIKKIRAAIDAEYPGRLLLAEANMWPEDVREYFGDGDECHMAYHFPLMPRMYMAIAQEDR
HPIVEIMQQTPEIPEDCQWAIFLRNHDELTLEMVTNRERDYMYNTYAADKQARINLGIRR
RLAPLMDNDKDRIKLMNSMLLSMPGSPIIYYGDEIGMGDNVFVGDRNGVRTPMQWNSDRN
AGFSRADPQRLYLQPIMDPMYGYESINVESQLRDKSSLLHWTRRMLAVRKTSRAFGRGQR
VFLKPGNRKILAYISEYGDDTILSVFNLSRAAQPVELDLSAYVGRVPVEMLGRTAFPPIG
DLPYLLTLPSYGFYWFNLSSDAAMPTWHEESVALPERPMLVLFDGWTSLFRDRVMPWRIG
MAERLRIQFETEALPRHIEVQRWYATKAHAISRARLLDESIWQDGDTSWLLPILEIQGPP
EPALYFMPLALAWEDSEEERMKSLEPGALAKVRQQAQVGVMGDAFFDERFTHAVVRAIAR
ETQVDTRDGQLHFVPTALGRALDLPQIAALPVSRPSPVSSNTVVTVGEALFLKGYRQLRV
GIHPEAEVGRFLTEKAAFPHCVPVLGSIEYTAKDGRRITLGLLQSYVSNQGDGWAFAMDY
LARFLSQLRDANEQSAPDVHGVFVSLMQMLGQRTAELHAALALRTGDPAFDPEPLTAQDV
EGLREHARSEAATTWELLRTSLESLPAAVQDDARRVLERQAEALARIDTLQTAGKTGLRT
RFHGDYHLGQALVSRNDFVIIDFEGEPARSFDERRTKSSPLRDVAGMLRSFNYARWSALR
QQAQNANELTRLDAAARDWEQQTRAAFLAGYGRTDAANTGLDTQLLELFELEKACYELRY
ELGNRIDWVTVPLRGILALLDRGASR
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacccatgccggtactggcactcgaaacggtcgaaatcgacacctcgggcgat
ccaacctggtatcgcgatgcagtggtctaccagctcaacgtcaaggccttctcggattcc
aatagcgacggcgttggcgacttcaagggcgtgacgtcaaagctcgattacgtccaagat
ctgggtgtcaacaccatctggctgatgccgttctatccgtcgccgctgcgcgacgatggc
tatgacatctcggaatacgaagacgtgcacccgcaatacggcacgctggccgacttccgc
gaaatgctggaagaagcgcacaaacggggcctgcgtgtgatcaccgaactggtcatcaac
cacacgtcggaccagcacccctggtttcaggcggcgcgcaacgcaccgcccggttcgccc
gaacgcgacttctatgtgtggagcgacaccgatcagctctaccagggcacgcgcatcatt
ttcaccgacaccgaaaaatccaactggacctgggacccggtggccaagcagtatttctgg
caccgcttcttcagccaccagccagatttgaacttcgacaacccccaggtgctggaagcg
gtgtaccgcaccatgcgcttctggctcgacatgggcgtggacggtttccggctcgacgcc
atcccctacctgattgagcgcgacggcaccagcaacgaaaacctgcccgagacacacgag
gttatcaagaaaattcgcgcggccatcgacgccgagtatccgggccgattgttgctggcc
gaagccaatatgtggcccgaggacgtgcgcgagtatttcggcgacggcgacgaatgccac
atggcctaccacttcccgctgatgccgcgcatgtacatggcgatcgcgcaagaggaccga
catccgattgttgaaatcatgcagcagacgcccgagattcccgaggactgccagtgggcc
atcttcctgcgcaatcacgatgaactcacgctggaaatggtgaccaaccgcgagcgcgac
tacatgtacaacacctatgcggccgacaagcaggcccgcatcaacctgggtattcggcgg
cgcctcgcgccgctgatggacaacgacaaagaccgcatcaagctgatgaacagcatgctg
ctgtccatgcccggatcgcccatcatctactacggcgacgagatcggaatgggcgacaac
gtttttgtgggcgaccgcaatggcgtgcgcaccccgatgcagtggaactccgaccgcaac
gccggattttcccgcgcggatccgcagcgcctttacctgcagccgatcatggatcccatg
tacggctatgaatcgatcaatgtcgagagccagttgcgagacaagagctcgctgctgcac
tggacacggcgcatgctcgcagtgcgcaagaccagtcgtgcctttggccggggacagcgg
gtgttcctcaaacccggcaaccgcaagatactggcctatatcagcgagtatggcgatgac
accatcctgtcggtcttcaatctctcgcgtgccgcgcagccggtcgagctggacttgtcg
gcctatgttggccgtgtgccggtcgaaatgctgggccgcaccgcttttccgccgatcggc
gacctgccctatctgctgaccctcccctcctacggtttctattggttcaatctttcgtcc
gacgccgccatgcccacctggcacgaggagagcgtggccttaccggagcggcccatgctg
gtacttttcgacggctggaccagcctgtttcgggaccgcgtcatgccatggcgcatcggt
atggccgagcgcctgcgcatccaattcgaaaccgaagccctgccgcgccatattgaagtg
cagcgctggtatgccaccaaggcacatgccatcagccgtgcacggctgctggatgaatcc
atctggcaagacggtgatacaagctggctgctgccgattctggagattcaggggccgcca
gaaccggccttgtacttcatgccgctggcgctcgcctgggaggactccgaagaagaacgc
atgaagagtctggagccaggtgccttggccaaggtgcgtcagcaggcacaagtgggtgtc
atgggcgatgccttttttgacgaacgcttcacccacgccgtggttcgcgccatcgccagg
gagacccaagtcgacacgcgagacgggcagttgcattttgtgccgacggcgctcggccgt
gcgcttgatctgccgcagatagctgctttgccggtcagccggcccagcccggtcagcagc
aacaccgtcgtcaccgtcggcgaggctttgttcctcaagggctaccgacagctgcgcgtg
ggcatccaccccgaggccgaagtgggccgctttctgacagagaaggcagcttttccccat
tgcgttccggtgcttggctcgatcgagtacaccgcgaaggatggtcgccgcatcacgttg
ggcttgctgcaatcgtatgtgtcaaaccagggcgatggctgggcgttcgcgatggactat
ttggcgcgtttcctgagccagttgcgcgatgccaacgagcagagcgcccccgacgtccac
ggcgtattcgtttcgttgatgcagatgctggggcaacgcacggcggaactgcacgctgcg
ctggcgctgcgcaccggcgatcccgctttcgatcctgagccgctcacagcgcaggatgtg
gaaggcctgcgcgaacacgcacgcagcgaagcagccaccacctgggagctactgcgcacc
agtctggagtctctcccggccgccgtccaggacgatgcgcggcgcgtgctggagcgccag
gcggaagcactggcgcgcatcgacacgttgcagactgcagggaaaaccggtctgcgcacg
cgctttcatggtgactaccaccttggccaggcattggtgtcgcgcaacgactttgtcatc
attgatttcgaaggtgaaccggcacgcagttttgacgagcgacgcaccaagagttccccg
ctgcgcgacgtggccggcatgttgcgatcgttcaactacgcgcgctggagcgcgttgcga
cagcaggcccaaaatgcgaatgaactgacgcgactggacgcagccgcacgcgactgggag
cagcaaacacgggctgcgttcctggccgggtatggcaggacggacgcagcaaacacgggc
ctcgatacccaacttctcgaactcttcgagctggagaaggcctgctatgaattgcggtat
gagctgggcaaccgcatcgactgggtgaccgtaccgctgcgcggcatcctggcgctgctt
gaccgcggtgcgagccgctga

DBGET integrated database retrieval system